From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002836000
  • symbol?:
  • description?: putative thioredoxin

      descriptions from strain specific annotations:

    • putative thioredoxin
    • Thioredoxin
    • thioredoxin family protein
  • strand?: +
  • coordinates?: 3289187..3289483
  • synteny block?: BlockID0020200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0791
    08BA02176:
    C248_0905
    11819-97:
    MS7_0863
    71193:
    ST398NM01_0891
    ECT-R 2:
    ECTR2_763
    ED133:
    SAOV_0853
    ED98:
    SAAV_0782
    HO 5096 0412:
    SAEMRSA15_07380
    JH1:
    SaurJH1_0853
    JH9:
    SaurJH9_0837
    JKD6008:
    SAA6008_00834
    JKD6159:
    SAA6159_00767
    LGA251:
    SARLGA251_07420
    M013:
    M013TW_0802
    MRSA252:
    SAR0868
    MSHR1132:
    SAMSHR1132_07600
    MSSA476:
    SAS0777
    Mu3:
    SAHV_0832
    Mu50:
    SAV0836
    MW2:
    MW0789
    RF122:
    SAB0767
    ST398:
    SAPIG0891
    T0131:
    SAT0131_00911
    TCH60:
    HMPREF0772_12367
    TW20:
    SATW20_08850
    USA300_TCH1516:
    USA300HOU_0846
    VC40:
    SAVC_03715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQF
    N315            MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQF
    NCTC8325        MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQF
    Newman          MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQF
    USA300_FPR3757  MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQF
                    ************************************************************

    COL             CKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK
    N315            CKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK
    NCTC8325        CKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK
    Newman          CKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK
    USA300_FPR3757  CKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK
                    **************************************