From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0779 [new locus tag: NWMN_RS04410 ]
  • pan locus tag?: SAUPAN002836000
  • symbol: NWMN_0779
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0779 [new locus tag: NWMN_RS04410 ]
  • symbol: NWMN_0779
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 869364..869660
  • length: 297
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAATAATTCATTAGACATCAAAGATGTAACTACATTTTATGAGGAAGACAAACATTTA
    ATCTTTGGTTATACACCAACGTGTGGTACTTGTAAGGTTTCAGAAAGAATGTTAGACATT
    GCTAATGAAATATTGCAGTTACCATTATTGAAAATAGATTTAAACTTTTATCCTCAGTTT
    TGTAAAGATATGCAAATCATGTCTACGCCGATTTTATTGTTGATGAATAAAGATAAAGAA
    GTAAAACGAATTTATGCATTTAAATCGGTGACTGATTTGTTAGAAAATTTAAAATAG
    60
    120
    180
    240
    297

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0779 [new locus tag: NWMN_RS04410 ]
  • symbol: NWMN_0779
  • description: hypothetical protein
  • length: 98
  • theoretical pI: 5.10475
  • theoretical MW: 11454.4
  • GRAVY: -0.118367

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismElectron transportthioredoxin (TIGR01068; HMM-score: 32.7)
    Genetic information processingProtein fateProtein folding and stabilizationprotein disulfide-isomerase domain (TIGR01126; HMM-score: 18.6)
    putative alkyl hydroperoxide reductase F subunit (TIGR03143; EC 1.6.4.-; HMM-score: 14.9)
  • TheSEED:  
    Thioredoxin 
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 34.2)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 14.6)
    DUF836; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 14.3)
    TraF; F plasmid transfer operon protein (PF13728; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.097
    • Ymax_pos: 44
    • Cmax: 0.103
    • Cmax_pos: 30
    • Smax: 0.12
    • Smax_pos: 35
    • Smean: 0.084
    • D: 0.092
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQFCKDMQIMSTPILLLMNKDKEVKRIYAFKSVTDLLENLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]