From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0778 [new locus tag: NWMN_RS04405 ]
  • pan locus tag?: SAUPAN002835000
  • symbol: NWMN_0778
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0778 [new locus tag: NWMN_RS04405 ]
  • symbol: NWMN_0778
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 868976..869371
  • length: 396
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    GTGATGATGATGGCTATTGTAAATAAAGTGATAATTGTTGAAGGAAAATCTGATAAAAAA
    AGGGTGCAACAGGTTATTGCAGAACCAGTCAATATTATTTGTACTCATGGAACAATGAGT
    ATAGATAAGCTTGATGATATGATAGAATCACTGTATGATAAACAAGTTTTTGTATTAGCC
    GATTCTGATGACGAAGGAGATCGAATTAGAAATTGGTTTAAACGTTATTTGAGTGAAAGT
    GAACATATATTTATTGATAAAACTTACTGTCAAGTTGCGAATTGCCCCAAACAATATTTG
    GCGCATGTACTTTCAAAACATGGCTTTACTTGTAAGAAAGAAACACCTCTTTTACCGAAT
    ATAAATAATGAAAGGTTAGTTTTAGTAAATGAATAA
    60
    120
    180
    240
    300
    360
    396

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0778 [new locus tag: NWMN_RS04405 ]
  • symbol: NWMN_0778
  • description: hypothetical protein
  • length: 131
  • theoretical pI: 6.505
  • theoretical MW: 15145.5
  • GRAVY: -0.254198

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionRNA processingribonuclease M5 (TIGR00334; EC 3.1.26.8; HMM-score: 51.4)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA gyrase, B subunit (TIGR01059; EC 5.99.1.3; HMM-score: 15.1)
  • TheSEED:  
    Toprim domain protein 
  • PFAM:
    Toprim-like (CL0413) Toprim; Toprim domain (PF01751; HMM-score: 21.4)
    no clan definedDUF2100; Uncharacterized protein conserved in archaea (DUF2100) (PF09873; HMM-score: 16.5)
    Toprim-like (CL0413) Toprim_4; Toprim domain (PF13662; HMM-score: 13.4)
    Toprim_2; Toprim-like (PF13155; HMM-score: 13.3)
    no clan definedCalc_CGRP_IAPP; Calcitonin / CGRP / IAPP family (PF00214; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.169
    • Ymax_pos: 20
    • Cmax: 0.113
    • Cmax_pos: 20
    • Smax: 0.294
    • Smax_pos: 15
    • Smean: 0.226
    • D: 0.191
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MMMMAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLADSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPNINNERLVLVNE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]