From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002899000
  • symbol?: sufB
  • description?: Iron-sulfur cluster assembly protein SufB

      descriptions from strain specific annotations:

    • Iron-sulfur cluster assembly protein SufB
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC transporter-associated protein
    • FeS assembly protein SufB
    • ABC transporter ATP-binding protein
  • strand?: +
  • coordinates?: 3343571..3344977
  • synteny block?: BlockID0020650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0918 (sufB)
    N315:
    NCTC8325:
    Newman:
    NWMN_0789 (sufB)
    USA300_FPR3757:
    04-02981:
    SA2981_0801 (sufB)
    08BA02176:
    C248_0915
    11819-97:
    MS7_0873 (sufB)
    71193:
    ST398NM01_0901
    ECT-R 2:
    ECTR2_773 (sufB)
    ED133:
    SAOV_0863
    ED98:
    SAAV_0817 (sufB)
    HO 5096 0412:
    SAEMRSA15_07480
    JH1:
    SaurJH1_0863
    JH9:
    SaurJH9_0847
    JKD6008:
    SAA6008_00868 (sufB)
    JKD6159:
    SAA6159_00777 (sufB)
    LGA251:
    SARLGA251_07750
    M013:
    M013TW_0838
    MRSA252:
    SAR0880
    MSHR1132:
    SAMSHR1132_07700
    MSSA476:
    SAS0788
    Mu3:
    SAHV_0842
    Mu50:
    SAV0846
    MW2:
    MW0799
    RF122:
    SAB0778
    ST398:
    SAPIG0901 (sufB)
    T0131:
    SAT0131_00945
    TCH60:
    HMPREF0772_12330 (sufB)
    TW20:
    SATW20_09180
    USA300_TCH1516:
    USA300HOU_0875
    VC40:
    SAVC_03765

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKKAPDVGDYKYGFHDDDVSIFRSERGLTENIVREISNMKNEPEWMLDFRLKSLKLFYK
    N315            MAKKAPDVGDYKYGFHDDDVSIFRSERGLTENIVREISNMKNEPEWMLDFRLKSLKLFYK
    NCTC8325        MAKKAPDVGDYKYGFHDDDVSIFRSERGLTENIVREISNMKNEPEWMLDFRLKSLKLFYK
    Newman          MAKKAPDVGDYKYGFHDDDVSIFRSERGLTENIVREISNMKNEPEWMLDFRLKSLKLFYK
    USA300_FPR3757  MAKKAPDVGDYKYGFHDDDVSIFRSERGLTENIVREISNMKNEPEWMLDFRLKSLKLFYK
                    ************************************************************

    COL             MPMPQWGGDLSELNFDDITYYVKPSEQAERSWDEVPEEIKRTFDKLGIPEAEQKYLAGVS
    N315            MPMPQWGGDLSELNFDDITYYVKPSEQAERSWDEVPEEIKRTFDKLGIPEAEQKYLAGVS
    NCTC8325        MPMPQWGGDLSELNFDDITYYVKPSEQAERSWDEVPEEIKRTFDKLGIPEAEQKYLAGVS
    Newman          MPMPQWGGDLSELNFDDITYYVKPSEQAERSWDEVPEEIKRTFDKLGIPEAEQKYLAGVS
    USA300_FPR3757  MPMPQWGGDLSELNFDDITYYVKPSEQAERSWDEVPEEIKRTFDKLGIPEAEQKYLAGVS
                    ************************************************************

    COL             AQYESEVVYHNMEKELEEKGIIFKDTDSALQENEELFKKYFASVVPAADNKFAALNSAVW
    N315            AQYESEVVYHNMEKELEEKGIIFKDTDSALQENEELFKKYFASVVPAADNKFAALNSAVW
    NCTC8325        AQYESEVVYHNMEKELEEKGIIFKDTDSALQENEELFKKYFASVVPAADNKFAALNSAVW
    Newman          AQYESEVVYHNMEKELEEKGIIFKDTDSALQENEELFKKYFASVVPAADNKFAALNSAVW
    USA300_FPR3757  AQYESEVVYHNMEKELEEKGIIFKDTDSALQENEELFKKYFASVVPAADNKFAALNSAVW
                    ************************************************************

    COL             SGGSFIYVPKNIKLDTPLQAYFRINSENMGQFERTLIIADEGASVHYVEGCTAPVYTTSS
    N315            SGGSFIYVPKNIKLDTPLQAYFRINSENMGQFERTLIIADEGASVHYVEGCTAPVYTTSS
    NCTC8325        SGGSFIYVPKNIKLDTPLQAYFRINSENMGQFERTLIIADEGASVHYVEGCTAPVYTTSS
    Newman          SGGSFIYVPKNIKLDTPLQAYFRINSENMGQFERTLIIADEGASVHYVEGCTAPVYTTSS
    USA300_FPR3757  SGGSFIYVPKNIKLDTPLQAYFRINSENMGQFERTLIIADEGASVHYVEGCTAPVYTTSS
                    ************************************************************

    COL             LHSAVVEIIVHKDAHVRYTTIQNWANNVYNLVTKRTFVYENGNMEWVDGNLGSKLTMKYP
    N315            LHSAVVEIIVHKDAHVRYTTIQNWANNVYNLVTKRTFVYENGNMEWVDGNLGSKLTMKYP
    NCTC8325        LHSAVVEIIVHKDAHVRYTTIQNWANNVYNLVTKRTFVYENGNMEWVDGNLGSKLTMKYP
    Newman          LHSAVVEIIVHKDAHVRYTTIQNWANNVYNLVTKRTFVYENGNMEWVDGNLGSKLTMKYP
    USA300_FPR3757  LHSAVVEIIVHKDAHVRYTTIQNWANNVYNLVTKRTFVYENGNMEWVDGNLGSKLTMKYP
                    ************************************************************

    COL             NCVLLGEGAKGSTLSIAFAGKGQVQDAGAKMIHKAPNTSSTIVSKSISKNGGKVIYRGIV
    N315            NCVLLGEGAKGSTLSIAFAGKGQVQDAGAKMIHKAPNTSSTIVSKSISKNGGKVIYRGIV
    NCTC8325        NCVLLGEGAKGSTLSIAFAGKGQVQDAGAKMIHKAPNTSSTIVSKSISKNGGKVIYRGIV
    Newman          NCVLLGEGAKGSTLSIAFAGKGQVQDAGAKMIHKAPNTSSTIVSKSISKNGGKVIYRGIV
    USA300_FPR3757  NCVLLGEGAKGSTLSIAFAGKGQVQDAGAKMIHKAPNTSSTIVSKSISKNGGKVIYRGIV
                    ************************************************************

    COL             HFGRKAKGARSNIECDTLILDNESTSDTIPYNEVFNDQISLEHEAKVSKVSEEQLFYLMS
    N315            HFGRKAKGARSNIECDTLILDNESTSDTIPYNEVFNDQISLEHEAKVSKVSEEQLFYLMS
    NCTC8325        HFGRKAKGARSNIECDTLILDNESTSDTIPYNEVFNDQISLEHEAKVSKVSEEQLFYLMS
    Newman          HFGRKAKGARSNIECDTLILDNESTSDTIPYNEVFNDQISLEHEAKVSKVSEEQLFYLMS
    USA300_FPR3757  HFGRKAKGARSNIECDTLILDNESTSDTIPYNEVFNDQISLEHEAKVSKVSEEQLFYLMS
                    ************************************************************

    COL             RGISEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKFEMEGSIG
    N315            RGISEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKFEMEGSIG
    NCTC8325        RGISEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKFEMEGSIG
    Newman          RGISEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKFEMEGSIG
    USA300_FPR3757  RGISEEEATEMIVMGFIEPFTKELPMEYAVEMNRLIKFEMEGSIG
                    *********************************************