From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003016000
  • symbol?:
  • description?: nitronate monooxygenase

      descriptions from strain specific annotations:

    • nitronate monooxygenase
    • 2-nitropropane dioxygenase family oxidoreductase
    • 2-nitropropane dioxygenase
    • Enoyl-(acyl-carrier-protein) reductase (FMN)
    • Enoyl-acyl-carrier-protein reductase FMN
    • nitronate monooxygenase family protein
    • pseudogene
    • putative dioxygenase
    • putative enoyl- reductase
    • Trans-enoyl-CoA reductase family
  • strand?: +
  • coordinates?: 3408857..3410978
  • synteny block?: BlockID0021240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0875
    08BA02176:
    C248_0919
    11819-97:
    MS7_0876
    71193:
    ST398NM01_0904
    ECT-R 2:
    ECTR2_776
    ED133:
    SAOV_0867
    ED98:
    SAAV_0881
    HO 5096 0412:
    SAEMRSA15_07510
    JH1:
    SaurJH1_0937
    JH9:
    SaurJH9_0919
    JKD6008:
    SAA6008_00872
    JKD6159:
    SAA6159_00780
    LGA251:
    SARLGA251_08390
    M013:
    M013TW_0840
    MRSA252:
    SAR0883
    MSHR1132:
    SAMSHR1132_07730
    MSSA476:
    SAS0791
    Mu3:
    SAHV_0915
    Mu50:
    SAV0920
    MW2:
    MW0803
    RF122:
    SAB0787
    ST398:
    SAPIG0904
    T0131:
    SAT0131_00950
    TCH60:
    HMPREF0772_12326 (fabK)
    TW20:
    SATW20_09210
    USA300_TCH1516:
    USA300HOU_0879
    VC40:
    SAVC_03780

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTIGAGYFNTQQLEDEIDYV
    N315            MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTIGAGYFNTQQLEDEIDYV
    NCTC8325        MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTIGAGYFNTQQLEDEIDYV
    Newman          MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTIGAGYFNTQQLEDEIDYV
    USA300_FPR3757  MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTIGAGYFNTQQLEDEIDYV
                    ************************************************************

    COL             RQLTSNSFGVNVFVPSQQSYTSSQIENMNAWLKPYRRALHLEEPVVKITEEQQFKCHIDT
    N315            RQLTSNSFGVNVFVPSQQSYTSSQIENMNAWLKPYRRALHLEEPVVKIIEEQQFKCHIDT
    NCTC8325        RQLTSNSFGVNVFVPSQQSYTSSQIENMNAWLKPYRRALHLEEPVVKITEEQQFKCHIDT
    Newman          RQLTSNSFGVNVFVPSQQSYTSSQIENMNAWLKPYRRALHLEEPVVKITEEQQFKCHIDT
    USA300_FPR3757  RQLTSNSFGVNVFVPSQQSYTSSQIENMNAWLKPYRRALHLEEPVVKITEEQQFKCHIDT
                    ************************************************ ***********

    COL             IIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAG
    N315            IIKKQVPVCCFTFGIPNESIIERLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAG
    NCTC8325        IIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAG
    Newman          IIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAG
    USA300_FPR3757  IIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAG
                    ****************.*.**.*** **:*******************************

    COL             GHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDGRGVLASIVLGAEGVQMGT
    N315            GHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDGRGVLASIVLGAEGVQMGT
    NCTC8325        GHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDGRGVLASIVLGAEGVQMGT
    Newman          GHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDGRGVLASIVLGAEGVQMGT
    USA300_FPR3757  GHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDGRGVLASIVLGAEGVQMGT
                    ************************************************************

    COL             AFLTSQDSNASELLRDAIINSKETDTVITKAFSGKLARGINNRFIEEMSQYEGDIPDYPI
    N315            AFLTSQDSNASELLRDAIINSKETDTVVTKAFSGKLARGINNRFIEEMSQYEGDIPDYPI
    NCTC8325        AFLTSQDSNASELLRDAIINSKETDTVITKAFSGKLARGINNRFIEEMSQYEGDIPDYPI
    Newman          AFLTSQDSNASELLRDAIINSKETDTVITKAFSGKLARGINNRFIEEMSQYEGDIPDYPI
    USA300_FPR3757  AFLTSQDSNASELLRDAIINSKETDTVITKAFSGKLARGINNRFIEEMSQYEGDIPDYPI
                    ***************************:********************************

    COL             QNELTSSIRKAAANIGDKELIHMWSGQSPRLATTHPANTIMSNIINQINQIMQYK
    N315            QNELTSSIRKAAANIGDKELTHMWSGQSPRLATTHPANTIMSNIINQINQIMQYK
    NCTC8325        QNELTSSIRKAAANIGDKELIHMWSGQSPRLATTHPANTIMSNIINQINQIMQYK
    Newman          QNELTSSIRKAAANIGDKELIHMWSGQSPRLATTHPANTIMSNIINQINQIMQYK
    USA300_FPR3757  QNELTSSIRKAAANIGDKELIHMWSGQSPRLATTHPANTIMSNIINQINQIMQYK
                    ******************** **********************************