From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0792 [new locus tag: NWMN_RS04480 ]
  • pan locus tag?: SAUPAN003016000
  • symbol: NWMN_0792
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0792 [new locus tag: NWMN_RS04480 ]
  • symbol: NWMN_0792
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 882009..883076
  • length: 1068
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGTGGAATAAGAATCGACTTACTCAAATGTTAAGTATTGAATATCCAATTATACAAGCA
    GGTATGGCAGGAAGTACGACACCGAAATTAGTTGCATCAGTAAGTAACAGTGGTGGGTTA
    GGCACAATAGGCGCAGGTTACTTTAATACGCAGCAATTGGAAGATGAAATAGATTATGTA
    CGCCAATTAACGTCAAATTCTTTTGGCGTAAATGTCTTTGTACCAAGTCAACAATCATAT
    ACCAGTAGTCAAATTGAAAATATGAATGCATGGTTAAAACCTTATCGACGCGCATTACAT
    TTAGAAGAGCCGGTTGTAAAAATTACCGAAGAACAACAATTTAAGTGTCATATTGATACG
    ATAATTAAAAAGCAAGTGCCTGTATGTTGTTTTACTTTTGGAATTCCAAGCGAACAGATT
    ATAAGCAGGTTGAAAGCAGCGAATGTCAAACTTATAGGTACAGCAACAAGTGTTGATGAA
    GCTATTGCGAATGAAAAAGCGGGTATGGATGCTATCGTTGCTCAAGGTAGTGAAGCAGGT
    GGACATCGTGGTTCATTTTTAAAACCTAAAAATCAATTACCTATGGTTGGAACAATATCT
    TTAGTGCCACAAATTGTAGATGTCGTTTCAATTCCGGTCATTGCCGCTGGTGGAATTATG
    GATGGTAGAGGAGTTTTGGCAAGTATTGTCTTAGGTGCAGAAGGGGTACAAATGGGCACC
    GCATTTTTAACATCACAAGACAGTAATGCATCAGAACTACTGCGAGATGCAATTATAAAT
    AGTAAAGAAACAGATACAGTCATTACAAAAGCGTTTAGTGGAAAGCTTGCACGCGGTATC
    AACAATAGGTTTATCGAAGAAATGTCCCAATACGAAGGCGATATCCCAGATTATCCAATA
    CAAAATGAGCTAACAAGTAGCATAAGAAAAGCCGCAGCAAACATCGGCGACAAAGAGTTA
    ATACATATGTGGAGTGGACAAAGCCCGCGACTAGCAACAACGCATCCCGCCAACACCATC
    ATGTCCAATATAATCAATCAAATTAATCAAATCATGCAATATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1068

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0792 [new locus tag: NWMN_RS04480 ]
  • symbol: NWMN_0792
  • description: hypothetical protein
  • length: 355
  • theoretical pI: 6.36803
  • theoretical MW: 38547.8
  • GRAVY: -0.102535

Function[edit source | edit]

  • reaction:
    EC 1.13.12.16?  ExPASy
    Nitronate monooxygenaseEthylnitronate + O2 = acetaldehyde + nitrite + other products
  • TIGRFAM:
    putative enoyl-[acyl-carrier-protein] reductase II (TIGR03151; EC 1.3.1.-; HMM-score: 233.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisinosine-5'-monophosphate dehydrogenase (TIGR01302; EC 1.1.1.205; HMM-score: 31.1)
    PfaD family protein (TIGR02814; HMM-score: 27.3)
    dihydroorotate dehydrogenase family protein (TIGR01037; EC 1.3.-.-; HMM-score: 24.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherisopentenyl-diphosphate delta-isomerase, type 2 (TIGR02151; EC 5.3.3.2; HMM-score: 18.8)
    Unknown functionGeneralIMP dehydrogenase family protein (TIGR01304; HMM-score: 17)
    heme/flavin dehydrogenase, mycofactocin system (TIGR03966; EC 1.-.-.-; HMM-score: 15.1)
    glycosyl amidation-associated protein WbuZ (TIGR03572; HMM-score: 12.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisdihydroorotate dehydrogenase (fumarate) (TIGR01036; EC 1.3.98.1; HMM-score: 11.8)
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsFatty acidsFatty Acid Biosynthesis FASII Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9) 
  • PFAM:
    TIM_barrel (CL0036) NMO; Nitronate monooxygenase (PF03060; HMM-score: 306.4)
    IMPDH; IMP dehydrogenase / GMP reductase domain (PF00478; HMM-score: 33.5)
    FMN_dh; FMN-dependent dehydrogenase (PF01070; HMM-score: 29.6)
    Glu_synthase; Conserved region in glutamate synthase (PF01645; HMM-score: 22.6)
    DHO_dh; Dihydroorotate dehydrogenase (PF01180; HMM-score: 21.5)
    DUF561; Protein of unknown function (DUF561) (PF04481; HMM-score: 16.2)
    His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: FMN
  • effectors:
  • protein partners:
    NWMN_1987(ddl)D-alanyl-alanine synthetase A  [1] (data from MRSA252)
    NWMN_1483(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    NWMN_0745(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    NWMN_0741(gapA)glyceraldehyde 3-phosphate dehydrogenase 1  [1] (data from MRSA252)
    NWMN_1580(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    NWMN_1937(groEL)chaperonin GroEL  [1] (data from MRSA252)
    NWMN_1348(ilvA)threonine dehydratase  [1] (data from MRSA252)
    NWMN_0176(ldh1)L-lactate dehydrogenase  [1] (data from MRSA252)
    NWMN_0961(pdhC)branched-chain alpha-keto acid dehydrogenase subunit E2  [1] (data from MRSA252)
    NWMN_0162(pflB)formate acetyltransferase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_0463(prs)ribose-phosphate pyrophosphokinase  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_2149(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    NWMN_2151(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    NWMN_2137(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    NWMN_0501(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_2120(rplM)50S ribosomal protein L13  [1] (data from MRSA252)
    NWMN_2150(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    NWMN_0504(rpoB)DNA-directed RNA polymerase subunit beta  [1] (data from MRSA252)
    NWMN_1166(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_0508(rpsG)30S ribosomal protein S7  [1] (data from MRSA252)
    NWMN_2119(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    NWMN_2143(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    NWMN_1167(tsf)elongation factor Ts  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_2016(upp)uracil phosphoribosyltransferase  [1] (data from MRSA252)
    NWMN_0346acetyl-CoA acetyltransferase  [1] (data from MRSA252)
    NWMN_0475cysteine synthase-like protein  [1] (data from MRSA252)
    NWMN_0641hypothetical protein  [1] (data from MRSA252)
    NWMN_0651hypothetical protein  [1] (data from MRSA252)
    NWMN_0811hypothetical protein  [1] (data from MRSA252)
    NWMN_1263aconitate hydratase  [1] (data from MRSA252)
    NWMN_1604universal stress protein family protein  [1] (data from MRSA252)
    NWMN_2504malate:quinone oxidoreductase  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.216
    • Ymax_pos: 23
    • Cmax: 0.12
    • Cmax_pos: 34
    • Smax: 0.538
    • Smax_pos: 19
    • Smean: 0.302
    • D: 0.249
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MWNKNRLTQMLSIEYPIIQAGMAGSTTPKLVASVSNSGGLGTIGAGYFNTQQLEDEIDYVRQLTSNSFGVNVFVPSQQSYTSSQIENMNAWLKPYRRALHLEEPVVKITEEQQFKCHIDTIIKKQVPVCCFTFGIPSEQIISRLKAANVKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVSIPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETDTVITKAFSGKLARGINNRFIEEMSQYEGDIPDYPIQNELTSSIRKAAANIGDKELIHMWSGQSPRLATTHPANTIMSNIINQINQIMQYK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [2] [3] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J. Bacteriol.: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)
  3. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J. Bacteriol.: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit source | edit]