From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2135 [new locus tag: NWMN_RS12340 ]
  • pan locus tag?: SAUPAN005685000
  • symbol: rpsE
  • pan gene symbol?: rpsE
  • synonym:
  • product: 30S ribosomal protein S5

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2135 [new locus tag: NWMN_RS12340 ]
  • symbol: rpsE
  • product: 30S ribosomal protein S5
  • replicon: chromosome
  • strand: -
  • coordinates: <2367334..2367822
  • length: 489
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGCTCGTAGAGAAGAAGAGACGAAAGAATTTGAAGAACGCGTTGTTACAATCAACCGT
    GTAGCAAAAGTTGTAAAAGGTGGTCGTCGTTTCCGTTTCACTGCATTAGTTGTAGTTGGA
    GACAAAAATGGTCGTGTAGGTTTCGGTACTGGTAAAGCTCAAGAGGTACCAGAAGCAATC
    AAAAAAGCTGTTGAAGCAGCTAAAAAAGATTTAGTAGTTGTTCCACGTGTTGAAGGTACA
    ACTCCACACACAATTACTGGCCGTTACGGTTCAGGAAGCGTATTTATGAAACCGGCTGCA
    CCTGGTACAGGAGTTATCGCTGGTGGTCCTGTTCGTGCCGTACTTGAATTAGCAGGTATC
    ACTGATATCTTAAGTAAATCATTAGGATCAAACACACCAATCAACATGGTTCGTGCTACA
    ATCGATGGTTTACAAAACCTTAAAAATGCTGAAGATGTTGCGAAATTACGTGGCAAAACA
    GTAGAAGAA
    60
    120
    180
    240
    300
    360
    420
    480
    489

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2135 [new locus tag: NWMN_RS12340 ]
  • symbol: RpsE
  • description: 30S ribosomal protein S5
  • length: 163
  • theoretical pI: 10.6781
  • theoretical MW: 17351.9
  • GRAVY: -0.20184

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uS5 (TIGR01021; HMM-score: 233.6)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uS5 (TIGR01020; HMM-score: 108.5)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome SSU bacterial SSU ribosomal protein S5p (S2e) 
    Protein processing and modificationRibosomal protein S5p acylation SSU ribosomal protein S5p (S2e) 
  • PFAM:
    S5 (CL0329) Ribosomal_S5_C; Ribosomal protein S5, C-terminal domain (PF03719; HMM-score: 112.1)
    DSRM (CL0196) Ribosomal_S5; Ribosomal protein S5, N-terminal domain (PF00333; HMM-score: 103.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.132
    • Ymax_pos: 42
    • Cmax: 0.13
    • Cmax_pos: 54
    • Smax: 0.238
    • Smax_pos: 2
    • Smean: 0.142
    • D: 0.136
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]