From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005685000
  • symbol?: rpsE
  • description?: 30S ribosomal protein S5
  • strand?: -
  • coordinates?: 5802821..5803321
  • synteny block?: BlockID0044310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2222 (rpsE)
    N315:
    SA2031 (rpsE)
    NCTC8325:
    Newman:
    NWMN_2135 (rpsE)
    USA300_FPR3757:
    04-02981:
    SA2981_2171 (rpsE)
    08BA02176:
    C248_2269 (rpsE)
    11819-97:
    MS7_2253 (rpsE)
    71193:
    ST398NM01_2286
    ECT-R 2:
    ECTR2_2095 (rpsE)
    ED133:
    SAOV_2270c
    ED98:
    SAAV_2295 (rpsE)
    HO 5096 0412:
    SAEMRSA15_21320 (rpsE)
    JH1:
    SaurJH1_2301 (rpsE)
    JH9:
    SaurJH9_2260 (rpsE)
    JKD6008:
    SAA6008_02270 (rpsE)
    JKD6159:
    SAA6159_02140 (rpsE)
    LGA251:
    SARLGA251_20190 (rpsE)
    M013:
    M013TW_2193
    MRSA252:
    SAR2318 (rpsE)
    MSHR1132:
    SAMSHR1132_20590
    MSSA476:
    SAS2124 (rpsE)
    Mu3:
    SAHV_2217 (rpsE)
    Mu50:
    SAV2233 (rpsE)
    MW2:
    MW2152 (rpsE)
    RF122:
    SAB2105c (rpsE)
    ST398:
    SAPIG2286 (rpsE)
    T0131:
    SAT0131_02406 (def)
    TCH60:
    HMPREF0772_10965 (rpsE)
    TW20:
    SATW20_23670 (rpsE)
    USA300_TCH1516:
    USA300HOU_2224 (rpsE)
    VC40:
    SAVC_10035 (rpsE)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAI
    N315            MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAI
    NCTC8325        MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAI
    Newman          MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAI
    USA300_FPR3757  MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAI
                    ************************************************************

    COL             KKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGI
    N315            KKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGI
    NCTC8325        KKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGI
    Newman          KKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGI
    USA300_FPR3757  KKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGI
                    ************************************************************

    COL             TDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEELYN
    N315            TDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEELYN
    NCTC8325        TDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEELYN
    Newman          TDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE---
    USA300_FPR3757  TDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEELYN
                    *******************************************