From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003021000
  • symbol?:
  • description?: bifunctional metallophosphatase/5'-nucleotidase

      descriptions from strain specific annotations:

    • bifunctional metallophosphatase/5'-nucleotidase
    • 5-nucleotidase family protein
    • 5'-nucleotidase
    • bifunctional 5-nucleotidase/2,3-cyclic phosphodiesterase
    • 5'-nucleotidase family protein in cluster withNagD-like phosphatase
    • calcineurin-like phosphoesterase family protein
    • metallophosphoesterase
    • putative 5'-nucleotidase
    • UDP-sugar hydrolase
  • strand?: +
  • coordinates?: 3413294..3414613
  • synteny block?: BlockID0021290
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0878
    08BA02176:
    C248_0923
    11819-97:
    MS7_0879
    71193:
    ST398NM01_0907
    ECT-R 2:
    ECTR2_779
    ED133:
    SAOV_0870
    ED98:
    SAAV_0884
    HO 5096 0412:
    SAEMRSA15_07540
    JH1:
    SaurJH1_0941
    JH9:
    SaurJH9_0922
    JKD6008:
    SAA6008_00875
    JKD6159:
    SAA6159_00783
    LGA251:
    SARLGA251_08420
    M013:
    M013TW_0843
    MRSA252:
    SAR0886
    MSHR1132:
    SAMSHR1132_07760
    MSSA476:
    SAS0794
    Mu3:
    SAHV_0918
    Mu50:
    SAV0923
    MW2:
    MW0806
    RF122:
    SAB0790
    ST398:
    SAPIG0907
    T0131:
    SAT0131_00954
    TCH60:
    HMPREF0772_12323
    TW20:
    SATW20_09240
    USA300_TCH1516:
    USA300HOU_0884
    VC40:
    SAVC_03795

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRLTIYHTNDIHSHLHEYERIKAYMAEHRPRLNHPSLYVDLGDHVDLSAPITEATLGKKN
    N315            MRLTIYHTNDIHSHLHEYERIKVYMAEQRPRLNHPSLYVDLGDHVDLSAPITEATLGKKN
    NCTC8325        MRLTIYHTNDIHSHLHEYERIKAYMAEHRPRLNHPSLYVDLGDHVDLSAPITEATLGKKN
    Newman          MRLTIYHTNDIHSHLHEYERIKAYMAEHRPRLNHPSLYVDLGDHVDLSAPITEATLGKKN
    USA300_FPR3757  MRLTIYHTNDIHSHLHEYERIKAYMAEHRPRLNHPSLYVDLGDHVDLSAPITEATLGKKN
                    **********************.****:********************************

    COL             VALLNEAKCDVATIGNNEGMTISHEALNHLYDEAKFIVTCSNVIDESGHLPNNIVSSYIK
    N315            VALLNEAKCDVATIGNNEGMTISHEALNHLYDEAKFIVTCSNVIDESGHLPNNIVSSYIK
    NCTC8325        VALLNEAKCDVATIGNNEGMTISYEALNHLYDEAKFIVTCSNVIDESGHLPNNIVSSYIK
    Newman          VALLNEAKCDVATIGNNEGMTISHEALNHLYDEAKFIVTCSNVIDESGHLPNNIVSSYIK
    USA300_FPR3757  VALLNEAKCDVATIGNNEGMTISHEALNHLYDEAKFIVTCSNVIDESGHLPNNIVSSYIK
                    ***********************:************************************

    COL             DIDGVKILFVAATAPFTPFYRALNWIVTDPLESIKEEIELQRGKFDVLIVLSHCGIFFDE
    N315            DMDGVKILFVAATAPFTPFYRALDWIVTDPLESIKEEIKHQRGKFDVIIVLSHCGIFFDE
    NCTC8325        DIDGVKILFVAATAPFTPFYRALNWIVTDPLESIKEEIELQRGKFDVLIVLSHCGIFFDE
    Newman          DIDGVKILFVAATAPFTPFYRALNWIVTDPLESIKEEIELQRGKFDVLIVLSHCGIFFDE
    USA300_FPR3757  DIDGVKILFVAATAPFTPFYRALNWIVTDPLESIKEEIELQRGKFDVLIVLSHCGIFFDE
                    *:*********************:**************: *******:************

    COL             TLCQELPEIDVIFGSHTHHYFEHGEINNGVLMAAAGKYGNYLGEVNLTFEAHKVVHKTAK
    N315            TLCQELPEIDVIFGSHTHHYFEHGEINNGVLMAAAGKYGNYLGEVNLTFEAHKVVHKTAK
    NCTC8325        TLCQELPEIDVIFGSHTHHYFEHGEINNGVLMAAAGKYGNYLGEVNLTFEAHKVVHKTAK
    Newman          TLCQELPEIDVIFGSHTHHYFEHGEINNGVLMAAAGKYGNYLGEVNLTFEAHKVVHKTAK
    USA300_FPR3757  TLCQELPEIDVIFGSHTHHYFEHGEINNGVLMAAAGKYGNYLGEVNLTFEAHKVVHKTAK
                    ************************************************************

    COL             IIPLETLPEVETSFEEEGKTLMSNSVIQHPVVLKRSMNHITEAAYLLAQSVCEYTHAQCA
    N315            IIPLETLPEVETSFEEEGKTLMSNSVIQHPVVLKRSMNHITEAAYLLAQSVCEYTHAQCA
    NCTC8325        IIPLETLPEVETSFEEEGKTLMSNSVIQHPVVLKRSMNHITEAAYLLAQSVCEYTHAQCA
    Newman          IIPLETLPEVETSFEEEGKTLMSNSVIQHPVVLKRSMNHITEAAYLLAQSVCEYTHAQCA
    USA300_FPR3757  IIPLETLPEVETSFEEEGKTLMSNSVIQHPVVLKRSMNHITEAAYLLAQSVCEYTHAQCA
                    ************************************************************

    COL             IINAGLLVKDIVKDEVTEYNIHQMLPHPINMVRVRLFGVKLKEIIAKSNKQEYMYEHAQG
    N315            IINAGLLVKDIVKDEVTEYDIHQMLPHPINMVRVRLSGVKLKEIITKSNKQEYMYEHAQG
    NCTC8325        IINAGLLVKDIVKDEVTEYDIHQMLPHPINMVRVRLFGVKLKEIIAKSNKQEYMYEHAQG
    Newman          IINAGLLVKDIVKDEVTEYDIHQMLPHPINMVRVRLFGVKLKEIIAKSNKQEYMYEHAQG
    USA300_FPR3757  IINAGLLVKDIVKDEVTEYDIHQMLPHPINMVRVRLFGVKLKEIIAKSNKQEYMYEHAQG
                    *******************:**************** ********:**************

    COL             LGFRGNIFGGYILYNLGYIHSTGRYYLNGEEIEDDKEYVLGTIDMYTFGRYFPTLKELPK
    N315            LGFRGNIFGGYILYNLGYIHSTGRYYLNGEEIEDDKEYVLGTIDMYTFGRYFPTLKELPK
    NCTC8325        LGFRGNIFGGYILYNLGYIHSTGRYYLNGEEIEDDKEYVLGTIDMYTFGRYFPTLKELPK
    Newman          LGFRGNIFGGYILYNLGYIHSTGRYYLNGEEIEDDKEYVLGTIDMYTFGRYFPTLKELPK
    USA300_FPR3757  LGFRGNIFGGYILYNLGYIHSTGRYYLNGEEIEDDKEYVLGTIDMYTFGRYFPTLKELPK
                    ************************************************************

    COL             EYLMPEFLRDIFKEKLLEY
    N315            EYLMPEFLRDIFKEKLLEY
    NCTC8325        EYLMPEFLRDIFKEKLLEY
    Newman          EYLMPEFLRDIFKEKLLEY
    USA300_FPR3757  EYLMPEFLRDIFKEKLLEY
                    *******************