From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003028000
  • symbol?:
  • description?: glycerate dehydrogenase

      descriptions from strain specific annotations:

    • glycerate dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase
    • D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding subunit
    • D-isomer specific 2-hydroxyacid dehydrogenase family protein
    • Glyoxylate reductase / Glyoxylate reductase / Hydroxypyruvate reductase
    • glyoxylate reductase (Glycolate reductase)
    • D-isomer specific 2-hydroxyacid dehydrogenase NAD binding domain-containing protein
    • D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein
    • glyoxylate/hydroxypyruvate reductase B
    • glyoxylate reductase (NAD+)
  • strand?: +
  • coordinates?: 3419341..3420300
  • synteny block?: BlockID0021360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0885
    08BA02176:
    C248_0929
    11819-97:
    MS7_0885
    71193:
    ST398NM01_0913
    ECT-R 2:
    ECTR2_786
    ED133:
    SAOV_0876
    ED98:
    SAAV_0890
    HO 5096 0412:
    SAEMRSA15_07600
    JH1:
    SaurJH1_0948
    JH9:
    SaurJH9_0929
    JKD6008:
    SAA6008_00881
    JKD6159:
    SAA6159_00789
    LGA251:
    SARLGA251_08480
    M013:
    M013TW_0849
    MRSA252:
    SAR0892
    MSHR1132:
    SAMSHR1132_07820
    MSSA476:
    SAS0800
    Mu3:
    SAHV_0925
    Mu50:
    SAV0930
    MW2:
    MW0812
    RF122:
    SAB0796
    ST398:
    SAPIG0913
    T0131:
    SAT0131_00960 (alr)
    TCH60:
    HMPREF0772_12317 (ghrB)
    TW20:
    SATW20_09300
    USA300_TCH1516:
    USA300HOU_0890
    VC40:
    SAVC_03825

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
    N315            MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
    NCTC8325        -------------------------MWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
    Newman          MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
    USA300_FPR3757  MVKIVVSRKIPDKFYQQLSKLGDVVMWQKSLVPMPKDQFVTALRDADACFITLSEQIDAE
                                             ***********************************

    COL             ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
    N315            ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
    NCTC8325        ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
    Newman          ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
    USA300_FPR3757  ILAQSPNLKVIANMAVGYDNIDVESATANNVVVTNTPNVLTETTAELGFTLMLAIARRIV
                    ************************************************************

    COL             EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
    N315            EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
    NCTC8325        EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
    Newman          EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
    USA300_FPR3757  EAEKYVEADAWQSWGPYLLSGKDVFNSTIGIYGMGDIGKAFARRLQGFNTNILYHNRSRH
                    ************************************************************

    COL             KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
    N315            KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
    NCTC8325        KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
    Newman          KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
    USA300_FPR3757  KDAEADFNATYVSFETLLAESDFIICTAPLTKETHHKFNAEAFEQMKNDAIFINIGRGQI
                    ************************************************************

    COL             VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
    N315            VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
    NCTC8325        VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
    Newman          VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
    USA300_FPR3757  VDETALIDALDNKEILACGLDVLANEPIDHTHPLMGRDNVLITPHIGSASVTTRDNMIQL
                    ************************************************************

    COL             CINNIEAVMTNQVPHTPVN
    N315            CINNIEAVMTNQVPHTPVN
    NCTC8325        CINNIEAVMTNQVPHTPVN
    Newman          CINNIEAVMTNQVPHTPVN
    USA300_FPR3757  CINNIEAVMTNQVPHTPVN
                    *******************