From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003030000
  • symbol?: dltX
  • description?: teichoic acid D-Ala incorporation-associated protein DltX

      descriptions from strain specific annotations:

    • teichoic acid D-Ala incorporation-associated protein DltX
    • D-Ala-teichoic acid biosynthesis family protein
    • D-Ala-teichoic acid biosynthesis protein
    • membrane protein
  • strand?: +
  • coordinates?: 3420956..3421159
  • synteny block?: BlockID0021380
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0886
    08BA02176:
    C248_0930
    11819-97:
    MS7_0886
    71193:
    ST398NM01_0914
    ECT-R 2:
    ECTR2_787
    ED133:
    SAOV_0877
    ED98:
    SAAV_0892
    HO 5096 0412:
    SAEMRSA15_07610
    JH1:
    SaurJH1_0950
    JH9:
    SaurJH9_0931
    JKD6008:
    SAA6008_00882
    JKD6159:
    SAA6159_00790
    LGA251:
    SARLGA251_08490
    M013:
    M013TW_0850
    MRSA252:
    SAR0893
    MSHR1132:
    SAMSHR1132_07830
    MSSA476:
    SAS0801
    Mu3:
    SAHV_0926 (dltX)
    Mu50:
    SAV0931
    MW2:
    MW0813
    RF122:
    SAB0797
    ST398:
    SAPIG0914
    T0131:
    SAT0131_00961 (acpS)
    TCH60:
    HMPREF0772_12316
    TW20:
    SATW20_09310
    USA300_TCH1516:
    USA300HOU_0892
    VC40:
    SAVC_03830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
    N315            MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
    NCTC8325        MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
    Newman          MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF
                    **************************************************