From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0792 [new locus tag: SA_RS04525 ]
  • pan locus tag?: SAUPAN003030000
  • symbol: SA0792
  • pan gene symbol?: dltX
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0792 [new locus tag: SA_RS04525 ]
  • symbol: SA0792
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 898280..898432
  • length: 153
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGAAATCTAAAAGTAAACAGCCACCTAATAAATATGTTGAAGCATTCAAACCATATTTA
    TTAACACTATTGTATTTGGCAATATTTATTACTTTATATTTAATTTATGGCAGTGGCGAC
    ACACACAATAACTTCATTTATAATGAGTTCTAA
    60
    120
    153

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0792 [new locus tag: SA_RS04525 ]
  • symbol: SA0792
  • description: hypothetical protein
  • length: 50
  • theoretical pI: 9.38005
  • theoretical MW: 5908.84
  • GRAVY: -0.062

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Component involved in D-alanylation of teichoic acids 
  • PFAM:
    no clan definedDUF3687; D-Ala-teichoic acid biosynthesis protein (PF12459; HMM-score: 57.8)
    DUF3094; Protein of unknown function (DUF3094) (PF11293; HMM-score: 11.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.143
    • Ymax_pos: 12
    • Cmax: 0.138
    • Cmax_pos: 44
    • Smax: 0.264
    • Smax_pos: 4
    • Smean: 0.202
    • D: 0.166
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKSKSKQPPNKYVEAFKPYLLTLLYLAIFITLYLIYGSGDTHNNFIYNEF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]