From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0795 [new locus tag: SA_RS04540 ]
  • pan locus tag?: SAUPAN003033000
  • symbol: dltC
  • pan gene symbol?: dltC
  • synonym:
  • product: D-alanine--poly(phosphoribitol) ligase subunit 2

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0795 [new locus tag: SA_RS04540 ]
  • symbol: dltC
  • product: D-alanine--poly(phosphoribitol) ligase subunit 2
  • replicon: chromosome
  • strand: +
  • coordinates: 901134..901370
  • length: 237
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGGAATTTAGAGAACAAGTATTAAATTTATTAGCAGAAGTAGCAGAAAATGATATTGTA
    AAAGAAAATCCAGACGTAGAAATTTTTGAAGAAGGTATTATTGATTCTTTCCAAACAGTT
    GGATTATTATTAGAGATTCAAAATAAACTTGATATCGAAGTATCTATTATGGACTTTGAT
    AGAGATGAGTGGGCAACACCAAATAAAATCGTTGAAGCATTAGAAGAGTTACGATGA
    60
    120
    180
    237

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0795 [new locus tag: SA_RS04540 ]
  • symbol: DltC
  • description: D-alanine--poly(phosphoribitol) ligase subunit 2
  • length: 78
  • theoretical pI: 3.67678
  • theoretical MW: 9063.14
  • GRAVY: -0.164103

Function[edit source | edit]

  • reaction:
    EC 6.1.1.13?  ExPASy
    D-alanine--poly(phosphoribitol) ligaseATP + D-alanine + poly(ribitol phosphate) = AMP + diphosphate + O-D-alanyl-poly(ribitol phosphate)
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanD-alanine--poly(phosphoribitol) ligase, subunit 2 (TIGR01688; EC 6.1.1.13; HMM-score: 136.3)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisacyl carrier protein (TIGR00517; HMM-score: 13.5)
  • TheSEED:  
    D-Alanyl Lipoteichoic Acid Biosynthesis D-alanine--poly(phosphoribitol) ligase ACP subunit (EC 6.1.1.13) 
    Teichoic and lipoteichoic acids biosynthesis D-alanine--poly(phosphoribitol) ligase ACP subunit (EC 6.1.1.13) 
  • PFAM:
    PP-binding (CL0314) PP-binding; Phosphopantetheine attachment site (PF00550; HMM-score: 34.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 29
    • Cmax: 0.106
    • Cmax_pos: 29
    • Smax: 0.119
    • Smax_pos: 20
    • Smean: 0.075
    • D: 0.089
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFDRDEWATPNKIVEALEELR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]