From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003033000
  • symbol?: dltC
  • description?: D-alanine--poly(phosphoribitol) ligase subunit 2

      descriptions from strain specific annotations:

    • D-alanine--poly(phosphoribitol) ligase subunit 2
    • D-alanine-activating enzyme/D-alanine-D-alanyl, dltC protein
    • D-alanine--D-alanine ligase
    • D-alanine--poly(phosphoribitol) ligase, subunit 2
    • D-alanyl carrier protein
  • strand?: +
  • coordinates?: 3423861..3424097
  • synteny block?: BlockID0021410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0937 (dltC)
    N315:
    SA0795 (dltC)
    NCTC8325:
    Newman:
    NWMN_0805 (dltC)
    USA300_FPR3757:
    04-02981:
    SA2981_0889 (dltC)
    08BA02176:
    C248_0933 (dltC)
    11819-97:
    MS7_0889 (dltC)
    71193:
    ST398NM01_0917
    ECT-R 2:
    ECTR2_790 (dltC)
    ED133:
    SAOV_0880
    ED98:
    SAAV_0895 (dltC)
    HO 5096 0412:
    SAEMRSA15_07640 (dltC)
    JH1:
    SaurJH1_0953
    JH9:
    SaurJH9_0934
    JKD6008:
    SAA6008_00885 (dltC)
    JKD6159:
    SAA6159_00793 (dltC)
    LGA251:
    SARLGA251_08520 (dltC)
    M013:
    M013TW_0853
    MRSA252:
    SAR0896 (dltC)
    MSHR1132:
    SAMSHR1132_07860
    MSSA476:
    SAS0804
    Mu3:
    SAHV_0929 (dltC)
    Mu50:
    SAV0934 (dltC)
    MW2:
    MW0816 (dltC)
    RF122:
    SAB0800 (dltC)
    ST398:
    SAPIG0917 (dltC)
    T0131:
    SAT0131_00964
    TCH60:
    HMPREF0772_12313 (dltC)
    TW20:
    SATW20_09340 (dltC)
    USA300_TCH1516:
    USA300HOU_0895 (dltC)
    VC40:
    SAVC_03845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFD
    N315            MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFD
    NCTC8325        MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFD
    Newman          MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFD
    USA300_FPR3757  MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFD
                    ************************************************************

    COL             RDEWATPNKIVEALEELR
    N315            RDEWATPNKIVEALEELR
    NCTC8325        RDEWATPNKIVEALEELR
    Newman          RDEWATPNKIVEALEELR
    USA300_FPR3757  RDEWATPNKIVEALEELR
                    ******************