From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003032000
  • symbol?: dltB
  • description?: DltB membrane protein

      descriptions from strain specific annotations:

    • DltB membrane protein
    • DltB protein
    • activated D-alanine transport protein
    • D-alanine lipoteichoic acid and wall teichoic acid esterification protein
    • D-alanine transfer protein DltB
    • putative activated D-alanine transport protein
    • D-alanyl transfer protein DltB
    • D-alanine membrane transfer protein
    • protein dltB
    • membrane bound O-acyl transferase, MBOAT family protein
    • membrane bound O-acyl transferase MBOAT family protein
    • D-alanyl-lipoteichoic acid biosynthesis protein DltB
  • strand?: +
  • coordinates?: 3422629..3423843
  • synteny block?: BlockID0021400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0936 (dltB)
    N315:
    SA0794 (dltB)
    NCTC8325:
    Newman:
    NWMN_0804 (dltB)
    USA300_FPR3757:
    04-02981:
    SA2981_0888 (dltB)
    08BA02176:
    C248_0932 (dltB)
    11819-97:
    MS7_0888 (dltB)
    71193:
    ST398NM01_0916
    ECT-R 2:
    ECTR2_789
    ED133:
    SAOV_0879
    ED98:
    SAAV_0894 (dltB)
    HO 5096 0412:
    SAEMRSA15_07630 (dltB)
    JH1:
    SaurJH1_0952
    JH9:
    SaurJH9_0933
    JKD6008:
    SAA6008_00884 (dltB)
    JKD6159:
    SAA6159_00792 (dltB)
    LGA251:
    SARLGA251_08510 (dltB)
    M013:
    M013TW_0852
    MRSA252:
    SAR0895 (dltB)
    MSHR1132:
    SAMSHR1132_07850
    MSSA476:
    SAS0803
    Mu3:
    SAHV_0928 (dltB)
    Mu50:
    SAV0933 (dltB)
    MW2:
    MW0815 (dltB)
    RF122:
    SAB0799 (dltB)
    ST398:
    SAPIG0916
    T0131:
    SAT0131_00963
    TCH60:
    HMPREF0772_12314 (dltB)
    TW20:
    SATW20_09330 (dltB)
    USA300_TCH1516:
    USA300HOU_0894 (dltB)
    VC40:
    SAVC_03840

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIPYGDFTFFLIALIALLPVIILGFLGKRSYIYNGVVTAFMIVLIFSSDKHNLFDQKYLS
    N315            MIPYGDFTFFLIALIALLPVIILGFLGKRSYIYNGVVTAFMIVLIFSSDKHNLFDQKYLS
    NCTC8325        MIPYGDFTFFLIALIALLPVIILGFLGKRSYIYNGVVTAFMIVLIFSSDKHNLFDQKYLS
    Newman          MIPYGDFTFFLIALIALLPVIILGFLGKRSYIYNGVVTAFMIVLIFSSDKHNLFDQKYLS
    USA300_FPR3757  MIPYGDFTFFLIALIALLPVIILGFLGKRSYIYNGVVTAFMIVLIFSSDKHNLFDQKYLS
                    ************************************************************

    COL             VQLISFIIYVVWQVLLIMFYYHSKPKNNSFSKFVTVMVLSILPLALVKVLQSTWLGGHQI
    N315            VQLISFIIYVVWQVLLIMFYYHSKPKNNSFSKFVTVMVLSILPLALVKVLQSTWLGGHQI
    NCTC8325        VQLISFIIYVVWQVLLIMFYYHSKPKNNSFSKFVTVMVLSILPLALVKVLQSTWLGGHQI
    Newman          VQLISFIIYVVWQVLLIMFYYHSKPKNNSFSKFVTVMVLSILPLALVKVLQSTWLGGHQI
    USA300_FPR3757  VQLISFIIYVVWQVLLIMFYYHSKPKNNSFSKFVTVMVLSILPLALVKVLQSTWLGGHQI
                    ************************************************************

    COL             HFHESKLIEFVGFLGISYVTFKSVQLIMEIRDGSIKEIKVWKLIQFISFFPTISSGPIDR
    N315            HFHESKLIEFVGFLGISYVTFKSVQLIMEIRDGSIKEIKVWKLIQFISFFPTISSGPIDR
    NCTC8325        HFHESKLIEFVGFLGISYVTFKSVQLIMEIRDGSIKEIKVWKLIQFISFFPTISSGPIDR
    Newman          HFHESKLIEFVGFLGISYVTFKSVQLIMEIRDGSIKEIKVWKLIQFISFFPTISSGPIDR
    USA300_FPR3757  HFHESKLIEFVGFLGISYVTFKSVQLIMEIRDGSIKEIKVWKLIQFISFFPTISSGPIDR
                    ************************************************************

    COL             YKRFVKDDKKVPTGNEYRELVLKAIHMIMLGFLYKYIVAYFINTYAIMPLQLDLHGFVNL
    N315            YKRFVKDDKKVPTGNEYRELVLKAIHMIMLGFLYKYIVAYFINTYAIMPLQLDLHGFVNL
    NCTC8325        YKRFVKDDKKVPTGNEYRELVLKAIHMIMLGFLYKYIVAYFINTYAIMPLQLDLHGFVNL
    Newman          YKRFVKDDKKVPTGNEYRELVLKAIHMIMLGFLYKYIVAYFINTYAIMPLQLDLHGFVNL
    USA300_FPR3757  YKRFVKDDKKVPTGNEYRELVLKAIHMIMLGFLYKYIVAYFINTYAIMPLQLDLHGFVNL
                    ************************************************************

    COL             WLYMYAYSLYLFFDFAGYSLFAIAFSYLFGIKTPPNFDKPFKAKNIKDFWNRWHMTLSFW
    N315            WLYMYAYSLYLFFDFAGYSLFAIAFSYLFGIKTPPNFDKPFKAKNIKDFWNRWHMTLSFW
    NCTC8325        WLYMYAYSLYLFFDFAGYSLFAIAFSYLFGIKTPPNFDKPFKAKNIKDFWNRWHMTLSFW
    Newman          WLYMYAYSLYLFFDFAGYSLFAIAFSYLFGIKTPPNFDKPFKAKNIKDFWNRWHMTLSFW
    USA300_FPR3757  WLYMYAYSLYLFFDFAGYSLFAIAFSYLFGIKTPPNFDKPFKAKNIKDFWNRWHMTLSFW
                    ************************************************************

    COL             FRDCIYMRSLFYMSRKKLLKSQFAMSNVAFLINFFIMGIWHGIEVYYIVYGLYHAALFIG
    N315            FRDCIYMRSLFYMSRKKLLKSQFAMSNVAFLINFFIMGIWHGIEVYYIVYGLYHAALFIG
    NCTC8325        FRDCIYMRSLFYMSRKKLLKSQFAMSNVAFLINFFIMGIWHGIEVYYIVYGLYHAALFIG
    Newman          FRDCIYMRSLFYMSRKKLLKSQFAMSNVAFLINFFIMGIWHGIEVYYIVYGLYHAALFIG
    USA300_FPR3757  FRDCIYMRSLFYMSRKKLLKSQFAMSNVAFLINFFIMGIWHGIEVYYIVYGLYHAALFIG
                    ************************************************************

    COL             YGYYERWRKKHPPRWQNGFTTALSIVITFHFVTFGFLIFSGKLI
    N315            YGYYERWRKKHPPRWQNGFTTALSIVITFHFVTFGFLIFSGKLI
    NCTC8325        YGYYERWRKKHPPRWQNGFTTALSIVITFHFVTFGFLIFSGKLI
    Newman          YGYYERWRKKHPPRWQNGFTTALSIVITFHFVTFGFLIFSGKLI
    USA300_FPR3757  YGYYERWRKKHPPRWQNGFTTALSIVITFHFVTFGFLIFSGKLI
                    ********************************************