From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003037000
  • symbol?:
  • description?: NADH dehydrogenase family protein

      descriptions from strain specific annotations:

    • NADH dehydrogenase family protein
    • putative pyridine nucleotide-disulfide oxidoreductase
    • FAD-dependent pyridine nucleotide-disulfide oxidoreductase
    • NADH dehydrogenase
    • NADH dehydrogenase family
    • pseudogene
    • putative NADH dehydrogenase
    • pyridine nucleotide-disulfide oxidoreductase family protein
    • pyridine nucleotide-disulphide oxidoreductase
    • Pyridine oxidoreductase
  • strand?: -
  • coordinates?: 3426308..3427372
  • synteny block?: BlockID0021450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0893
    08BA02176:
    C248_0937
    11819-97:
    MS7_0893
    71193:
    ST398NM01_0921
    ECT-R 2:
    ECTR2_794
    ED133:
    SAOV_0884c
    ED98:
    SAAV_0899
    HO 5096 0412:
    SAEMRSA15_07680
    JH1:
    SaurJH1_0957
    JH9:
    SaurJH9_0938
    JKD6008:
    SAA6008_00889
    JKD6159:
    SAA6159_00797
    LGA251:
    SARLGA251_08560
    M013:
    M013TW_0857
    MRSA252:
    SAR0900
    MSHR1132:
    SAMSHR1132_07900
    MSSA476:
    SAS0808
    Mu3:
    SAHV_0933
    Mu50:
    SAV0938
    MW2:
    MW0820
    RF122:
    SAB0804c
    ST398:
    SAPIG0921
    T0131:
    SAT0131_00968
    TCH60:
    HMPREF0772_12309 (ndh2)
    TW20:
    SATW20_09380
    USA300_TCH1516:
    USA300HOU_0899
    VC40:
    SAVC_03865

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKNLVLLGGGYGNMRIMSRILTTSLPQDYTVTLVDRMPFHGLKPEFYALAAGTKSDKDVR
    NCTC8325        MKNLVLLGGGYGNMRIMSRILTTSLPQDYTVTLVDRMPFHGLKPEFYALAAGTKSDKDVR
    Newman          MKNLVLLGGGYGNMRIMSRILTTSLPQDYTVTLVDRMPFHGLKPEFYALAAGTKSDKDVR
    USA300_FPR3757  MKNLVLLGGGYGNMRIMSRILTTSLPQDYTVTLVDRMPFHGLKPEFYALAAGTKSDKDVR
                    ************************************************************

    N315            MKFPNHPQVNTVYGEINDIDLDAQIVSVGNSKIDYDELIIGLGCEDKYHNVPGAEEYTHS
    NCTC8325        MKFPNHPQVNTVYGEINDIDLDAQIVSVGNSKIDYDELIIGLGCEDKYHNVPGAEEYTHS
    Newman          MKFPNHPQVNTVYGEINDIDLDAQIVSVGNSKIDYDELIIGLGCEDKYHNVPGAEEYTHS
    USA300_FPR3757  MKFPNHPQVNTVYGEINDIDLDAQIVSVGNSKIDYDELIIGLGCEDKYHNVPGAEEYTHS
                    ************************************************************

    N315            IQTLSKARDTFHSISELPEGAKVGIVGAGLSGIELASELRESRSDLEIYLYDRGPRILRN
    NCTC8325        IQTLSKARDTFHSISELPEGAKVGIVGAGLSGIELASELRESRSDLEIYLYDRGPRILRN
    Newman          IQTLSKARDTFHSISELPEGAKVGIVGAGLSGIELASELRESRSDLEIYLYDRGPRILRN
    USA300_FPR3757  IQTLSKARDTFHSISELPEGAKVGIVGAGLSGIELASELRESRSDLEIYLYDRGPRILRN
                    ************************************************************

    N315            FPEKLSKYVAKWFAKNNVTVVPNSNINKVEPGKIYNCDEPKDIDLVVWTAGIQPVEVVRN
    NCTC8325        FPEKLSKYVAKWFAKNNVTVVPNSNINKVEPGKIYNCDEPKDIDLVVWTAGIQPVEVVRN
    Newman          FPEKLSKYVAKWFAKNNVTVVPNSNINKVEPGKIYNCDEPKDIDLVVWTAGIQPVEVVRN
    USA300_FPR3757  FPEKLSKYVAKWFAKNNVTVVPNSNINKVEPGKIYNCDEPKDIDLVVWTAGIQPVEVVRN
                    ************************************************************

    N315            LPIDINSNGRVIVNQYHQVPTYRNVYVVGDCADLPHAPSAQLAEVQGDQIADVLKKQWLN
    NCTC8325        LPIDINSNGRVIVNQYHQVPTYRNVYVVGDCADLPHAPSAQLAEVQGDQIADVLKKQWLN
    Newman          LPIDINSNGRVIVNQYHQVPTYRNVYVVGDCADLPHAPSAQLAEVQGDQIADVLKKQWLN
    USA300_FPR3757  LPIDINSNGRVIVNQYHQVPTYRNVYVVGDCADLPHAPSAQLAEVQGDQIADVLKKQWLN
                    ************************************************************

    N315            EPLPDKMPELKVQGIVGSLGDKQGFAYIMDRTVTGRLASILKSGVLWLYKYHNG
    NCTC8325        EPLPDKMPELKVQGIVGSLGDKQGFAYIMDRTVTGRLASILKSGVLWLYKYHNG
    Newman          EPLPDKMPELKVQGIVGSLGDKQGFAYIMDRTVTGRLASILKSGVLWLYKYHNG
    USA300_FPR3757  EPLPDKMPELKVQGIVGSLGDKQGFAYIMDRTVTGRLASILKSGVLWLYKYHNG
                    ******************************************************