From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003041000
  • symbol?: pepZ
  • description?: cytosol aminopeptidase

      descriptions from strain specific annotations:

    • cytosol aminopeptidase
    • leucyl aminopeptidase
    • Cytosol aminopeptidase PepA
    • cytosol aminopeptidase family protein
  • strand?: +
  • coordinates?: 3430550..3432836
  • synteny block?: BlockID0021490
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0803 (ampA)
    NCTC8325:
    Newman:
    NWMN_0812 (ampA)
    USA300_FPR3757:
    04-02981:
    SA2981_0897 (pepA)
    08BA02176:
    C248_0941 (pepA)
    11819-97:
    MS7_0897
    71193:
    ST398NM01_0925
    ECT-R 2:
    ECTR2_798
    ED133:
    SAOV_0888
    ED98:
    SAAV_0903
    HO 5096 0412:
    SAEMRSA15_07720 (pepA)
    JH1:
    SaurJH1_0961
    JH9:
    SaurJH9_0942
    JKD6008:
    SAA6008_00895 (ampA)
    JKD6159:
    SAA6159_00801 (ampA)
    LGA251:
    SARLGA251_08600 (pepA)
    M013:
    M013TW_0861
    MRSA252:
    SAR0904 (pepA)
    MSHR1132:
    SAMSHR1132_07940
    MSSA476:
    SAS0812
    Mu3:
    SAHV_0937 (ampA)
    Mu50:
    SAV0942 (ampA)
    MW2:
    MW0824 (ampA)
    RF122:
    SAB0808
    ST398:
    SAPIG0925
    T0131:
    SAT0131_00974 (ddl)
    TCH60:
    HMPREF0772_12305 (pepA3)
    TW20:
    SATW20_09420 (pepA)
    USA300_TCH1516:
    VC40:
    SAVC_03885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNFKLNNTLSNEINTLIIGIPEHLNQLERISFNHIDITESLERLKHQHIIGSKVGKIYTT
    N315            MNFKLNNTLSNEINTLIIGIPEHLNQLERISFNHIDITESLERLKHQHIIGSKVGKIYTT
    NCTC8325        MNFKLNNTLSNEINTLIIGIPEHLNQLERISFNHIDITESLERLKHQHIIGSKVGKIYTT
    Newman          MNFKLNNTLSNEINTLIIGIPEHLNQLERISFNHIDITESLERLKHQHIIGSKVGKIYTT
    USA300_FPR3757  MNFKLNNTLSNEINTLIIGIPEHLNQLERISFNHIDITESLERLKHQHIIGSKVGKIYTT
                    ************************************************************

    COL             AFDVQDQTYRLITVGLGNLKTRSYQDMLKIWGHLFQYIKSEHIEDTYLLMDSFISKYDQL
    N315            AFDVQDQTYRLITVGLGNLKARSYQDMLKIWGHLFQYIKSEHIEDTYLLMDSFISKYDQL
    NCTC8325        AFDVQDQTYRLITVGLGNLKTRSYQDMLKIWGHLFQYIKSEHIEDTYLLMDSFISKYDQL
    Newman          AFDVQDQTYRLITVGLGNLKTRSYQDMLKIWGHLFQYIKSEHIEDTYLLMDSFISKYDQL
    USA300_FPR3757  AFDVQDQTYRLITVGLGNLKTRSYQDMLKIWGHLFQYIKSEHIEDTYLLMDSFISKYDQL
                    ********************:***************************************

    COL             SDVLMACGIQSERATYEFDHYKSSKKAPFKTNLNLISESLIELDFIHEGISIGQSINLAR
    N315            SDVLMACGIQSERATYEFDHYKSSKKAPFKTNLNLISESLIELDFIHEGISIGQSINLAR
    NCTC8325        SDVLMACGIQSERATYEFDHYKSSKKAPFKTNLNLISESLIELDFIHEGISIGQSINLAR
    Newman          SDVLMACGIQSERATYEFDHYKSSKKAPFKTNLNLISESLIELDFIHEGISIGQSINLAR
    USA300_FPR3757  SDVLMACGIQSERATYEFDHYKSSKKAPFKTNLNLISESLIELDFIHEGISIGQSINLAR
                    ************************************************************

    COL             DFSNMPPNVLTPQTFAEDIVNHFKNTKVKVDVKDYDTLVSEGFGLLQAVGKGSKHKPRLV
    N315            DFSNMPPNVLTPQTFAEDIVNHFKNTKVKVDVKDYDTLVSEGFGLLQAVGKGSKHKPRLV
    NCTC8325        DFSNMPPNVLTPQTFAEDIVNHFKNTKVKVDVKDYDTLVSEGFGLLQAVGKGSKHKPRLV
    Newman          DFSNMPPNVLTPQTFAEDIVNHFKNTKVKVDVKDYDTLVSEGFGLLQAVGKGSKHKPRLV
    USA300_FPR3757  DFSNMPPNVLTPQTFAEDIVNHFKNTKVKVDVKDYDTLVSEGFGLLQAVGKGSKHKPRLV
                    ************************************************************

    COL             TITYNGKDKDEAPIALVGKGITYDSGGYSIKTKNGMATMKFDMCGAANVVGIIEAASRLQ
    N315            TITYNGKDKDVAPIALVGKGITYDSGGYSIKTKNGMATMKFDMCGAANVVGIIEAASRLQ
    NCTC8325        TITYNGKDKDEAPIALVGKGITYDSGGYSIKTKNGMATMKFDMCGAANVVGIIEAASRLQ
    Newman          TITYNGKDKDEAPIALVGKGITYDSGGYSIKTKNGMATMKFDMCGAANVVGIIEAASRLQ
    USA300_FPR3757  TITYNGKDKDEAPIALVGKGITYDSGGYSIKTKNGMATMKFDMCGAANVVGIIEAASRLQ
                    ********** *************************************************

    COL             LPVNIVGVLACAENMINEASMKPDDVFTALSGETVEVMNTDAEGRLVLADAVFYANQYQP
    N315            LPVNIVGVLACAENMINEASMKPDDVFTALSGETVEVMNTDAEGRLVLADAVYYANQYQP
    NCTC8325        LPVNIVGVLACAENMINEASMKPDDVFTALSGETVEVMNTDAEGRLVLADAVFYANQYQP
    Newman          LPVNIVGVLACAENMINEASMKPDDVFTALSGETVEVMNTDAEGRLVLADAVFYANQYQP
    USA300_FPR3757  LPVNIVGVLACAENMINEASMKPDDVFTALSGETVEVMNTDAEGRLVLADAVFYANQYQP
                    ****************************************************:*******

    COL             SVIMDFATLTGAAIVALGDDKAAAFESNSKVILNDILQISSEVDEMVFELPITATERASI
    N315            SVIMDFATLTGAAIVALGDDKAAAFESNSKVILNDILQISSKVDEMVFELPITATERASI
    NCTC8325        SVIMDFATLTGAAIVALGDDKAAAFESNSKVILNDILQISSEVDEMVFELPITATERASI
    Newman          SVIMDFATLTGAAIVALGDDKAAAFESNSKVILNDILQISSEVDEMVFELPITATERASI
    USA300_FPR3757  SVIMDFATLTGAAIVALGDDKAAAFESNSKVILNDILQISSEVDEMVFELPITATERASI
                    *****************************************:******************

    COL             KHSDIADLVNHTNGQGKALFAASFVTHFSGQTPHIHFDIAGPATTNKASYNGPKGPTGFM
    N315            NHSDIADLVNHTNGQGKALFAASFVTHFSGQTPHIHFDIAGPATTNKASYNGPKGPTGFM
    NCTC8325        KHSDIADLVNHTNGQGKALFAASFVTHFSGQTPHIHFDIAGPATTNKASYNGPKGPTGFM
    Newman          KHSDIADLVNHTNGQGKALFAASFVTHFSGQTPHIHFDIAGPATTNKASYNGPKGPTGFM
    USA300_FPR3757  KHSDIADLVNHTNGQGKALFAASFVTHFSGQTPHIHFDIAGPATTNKASYNGPKGPTGFM
                    :***********************************************************

    COL             IPTIVQWLKQQ
    N315            IPTIVQWLKQQ
    NCTC8325        IPTIVQWLKQQ
    Newman          IPTIVQWLKQQ
    USA300_FPR3757  IPTIVQWLKQQ
                    ***********