From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003043000
  • symbol?:
  • description?: sodium:proton antiporter

      descriptions from strain specific annotations:

    • sodium:proton antiporter
    • Na+/H+ antiporter family protein
    • citrate transporter family protein
    • dctM-like transporters family protein
    • Histidine permease YuiF
    • Na+/H+ antiporter NhaC
    • Na+ antiporter NhaC
    • NhaC family Na(+)/H(+) antiporter
    • NhaC family sodium:proton (Na+:H+) antiporter
    • NhaC family sodium antiporter
    • putative transporter protein
    • transporter
  • strand?: +
  • coordinates?: 3433423..3434760
  • synteny block?: BlockID0021510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0898 (yuiF)
    08BA02176:
    C248_0942
    11819-97:
    MS7_0898
    71193:
    ST398NM01_0926
    ECT-R 2:
    ECTR2_799
    ED133:
    SAOV_0889
    ED98:
    SAAV_0904
    HO 5096 0412:
    SAEMRSA15_07730
    JH1:
    SaurJH1_0962
    JH9:
    SaurJH9_0943
    JKD6008:
    SAA6008_00896
    JKD6159:
    SAA6159_00802
    LGA251:
    SARLGA251_08610
    M013:
    M013TW_0862
    MRSA252:
    SAR0905
    MSHR1132:
    SAMSHR1132_07950
    MSSA476:
    SAS0813
    Mu3:
    SAHV_0938
    Mu50:
    SAV0943
    MW2:
    MW0825
    RF122:
    SAB0809
    ST398:
    SAPIG0926
    T0131:
    SAT0131_00975 (ftsW)
    TCH60:
    HMPREF0772_12304
    TW20:
    SATW20_09430
    USA300_TCH1516:
    USA300HOU_0903
    VC40:
    SAVC_03890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINAVVIAVILMIMLCLCRLNVVISLFISALVGGLISGMSIEKVINVFGKNIVDGAEVAL
    N315            MINAVVIAVILMIVLCLCRLNVVISLFISALVGGLISGMSIEKVINVFGKNIVDGAEVAL
    NCTC8325        MINAVVIAVILMIVLCLCRLNVVISLFISALVGGLISGMSIEKVINVFGKNIVDGAEVAL
    Newman          MINAVVIAVILMIVLCLCRLNVVISLFISALVGGLISGMSIEKVINVFGKNIVDGAEVAL
    USA300_FPR3757  MINAVVIAVILMIVLCLCRLNVVISLFISALVGGLISGMSIEKVINVFGKNIVDGAEVAL
                    *************:**********************************************

    COL             SYALLGGFAALISYSGITDYLVGKIINAIHAENSRWSRVKVKVTIIIALLAMSIMSQNLI
    N315            SYALLGGFAALISYSGITDYLVGKIINAIHAENSRWSRVKVKVTIIIALLAMSIMSQNLI
    NCTC8325        SYALLGGFAALISYSGITDYLVGKIINAIHAENSRWSRVKVKVTIIIALLAMSIMSQNLI
    Newman          SYALLGGFAALISYSGITDYLVGKIINAIHAENSRWSRVKVKVTIIIALLAMSIMSQNLI
    USA300_FPR3757  SYALLGGFAALISYSGITDYLVGKIINAIHAENSRWSRVKVKVTIIIALLAMSIMSQNLI
                    ************************************************************

    COL             PVHIAFIPIVIPPLLSLFNDLKIDRRLIGLIIGFGLCFPYVLLPYGFGQIFQQIIQSGFA
    N315            PVHIAFIPIVIPPLLSLFNDLKIDRRLIGLIIGFGLCFPYVLLPYGFGQIFQQIIQSGFA
    NCTC8325        PVHIAFIPIVIPPLLSLFNDLKIDRRLIGLIIGFGLCFPYVLLPYGFGQIFQQIIQSGFA
    Newman          PVHIAFIPIVIPPLLSLFNDLKIDRRLIGLIIGFGLCFPYVLLPYGFGQIFQQIIQSGFA
    USA300_FPR3757  PVHIAFIPIVIPPLLSLFNDLKIDRRLIGLIIGFGLCFPYVLLPYGFGQIFQQIIQSGFA
                    ************************************************************

    COL             KANHPIEFNMIWKAMLIPSMGYIVGLLIGLYVYRKPREYETRKISDSDNVTELKPYILIV
    N315            KANHPIEFNMIWKAMLIPSMGYIVGLLIGLYVYRKPREYETRKISDSDNVTELKPYILIV
    NCTC8325        KANHPIEFNMIWKAMLIPSMGYIVGLLIGLYVYRKPREYETRKISDSDNVTELKPYILIV
    Newman          KANHPIEFNMIWKAMLIPSMGYIVGLLIGLYVYRKPREYETRKISDSDNVTELKPYILIV
    USA300_FPR3757  KANHPIEFNMIWKAMLIPSMGYIVGLLIGLYVYRKPREYETRKISDSDNVTELKPYILIV
                    ************************************************************

    COL             TIVAILATFLVQTFTDSMIFGALAGVLVFFISRAYNWYELDAKFVEGIKIMAYIGVVILT
    N315            TIVAILATFLVQTFTDSMIFGALAGVLVFFISRAYNWYELDAKFVEGIKIMAYIGVVILT
    NCTC8325        TIVAILATFLVQTFTDSMIFGALAGVLVFFISRAYNWYELDAKFVEGIKIMAYIGVVILT
    Newman          TIVAILATFLVQTFTDSMIFGALAGVLVFFISRAYNWYELDAKFVEGIKIMAYIGVVILT
    USA300_FPR3757  TIVAILATFLVQTFTDSMIFGALAGVLVFFISRAYNWYELDAKFVEGIKIMAYIGVVILT
                    ************************************************************

    COL             ANGFAGVMNATGDIDELVKTLTSITGDNKLFSIIMMYVIGLIVTLGIGSSFATIPIIASL
    N315            ANGFAGVMNATGDIDELVKTLTSITGDNKLFSIIMMYVIGLIVTLGIGSSFATIPIIASL
    NCTC8325        ANGFAGVMNATGDIDELVKTLTSITGDNKLFSIIMMYVIGLIVTLGIGSSFATIPIIASL
    Newman          ANGFAGVMNATGDIDELVKTLTSITGDNKLFSIIMMYVIGLIVTLGIGSSFATIPIIASL
    USA300_FPR3757  ANGFAGVMNATGDIDELVKTLTSITGDNKLFSIIMMYVIGLIVTLGIGSSFATIPIIASL
                    ************************************************************

    COL             FIPFGASIGLDTMALIALIGTASALGDSGSPASDSTLGPTAGLNVDGQHDHIRDTCVPNF
    N315            FIPFGASIGLDTMALIALIGTASALGDSGSPASDSTLGPTAGLNVDGQHDHIRDTCVPNF
    NCTC8325        FIPFGASIGLDTMALIALIGTASALGDSGSPASDSTLGPTAGLNVDGQHDHIRDTCVPNF
    Newman          FIPFGASIGLDTMALIALIGTASALGDSGSPASDSTLGPTAGLNVDGQHDHIRDTCVPNF
    USA300_FPR3757  FIPFGASIGLDTMALIALIGTASALGDSGSPASDSTLGPTAGLNVDGQHDHIRDTCVPNF
                    ************************************************************

    COL             LFYNIPLMIFGTIAAMVL
    N315            LFYNIPLMIFGTIAAMVL
    NCTC8325        LFYNIPLMIFGTIAAMVL
    Newman          LFYNIPLMIFGTIAAMVL
    USA300_FPR3757  LFYNIPLMIFGTIAAMVL
                    ******************