From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003046000
  • symbol?:
  • description?: pyridine nucleotide-disulfide oxidoreductase

      descriptions from strain specific annotations:

    • pyridine nucleotide-disulfide oxidoreductase
    • pyridine nucleotide-disulfide oxidoreductase family protein
    • Thioredoxin reductase/alkyl hydroperoxide reductase
  • strand?: -
  • coordinates?: 3436865..3438019
  • synteny block?: BlockID0021540
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0900
    08BA02176:
    C248_0944
    11819-97:
    MS7_0900
    71193:
    ST398NM01_0928
    ECT-R 2:
    ECTR2_801
    ED133:
    SAOV_0891c
    ED98:
    SAAV_0906
    HO 5096 0412:
    SAEMRSA15_07750
    JH1:
    SaurJH1_0964
    JH9:
    SaurJH9_0945
    JKD6008:
    SAA6008_00898
    JKD6159:
    SAA6159_00804
    LGA251:
    SARLGA251_08630
    M013:
    M013TW_0864
    MRSA252:
    SAR0907
    MSHR1132:
    SAMSHR1132_07970
    MSSA476:
    SAS0815
    Mu3:
    SAHV_0940
    Mu50:
    SAV0945
    MW2:
    MW0827
    RF122:
    SAB0812c
    ST398:
    SAPIG0928
    T0131:
    SAT0131_00977
    TCH60:
    HMPREF0772_12302
    TW20:
    SATW20_09450
    USA300_TCH1516:
    USA300HOU_0905
    VC40:
    SAVC_03900

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHWTIIGGGIQGTAIAQKLLSSGLTTDRLTIIDPHETFCQRFNSYTNRIEMPYLRSPIVH
    N315            MHWTIIGGGIQGTAIAQKLLSSGLTTDLLTIIDPHETFCQRFNSYTNRIEMPYLRSPIVH
    NCTC8325        MHWTIIGGGIQGTAIAQKLLSSGLTTDRLTIIDPHETFCQRFNSYTNRIEMPYLRSPIVH
    Newman          MHWTIIGGGIQGTAIAQKLLSSGLTTDRLTIIDPHETFCQRFNSYTNRIEMPYLRSPIVH
    USA300_FPR3757  MHWTIIGGGIQGTAIAQKLLSSGLTTDRLTIIDPHETFCQRFNSYTNRIEMPYLRSPIVH
                    *************************** ********************************

    COL             HVHPQPFHLKQFAKQHQYTNAFYGPYQRPELTMFMDHIAHASKQYQLEDCLVQGLVQTLD
    N315            HVHPQPFHLKQFAKQHQYTNAFYGPYQRPELTMFMNHIAHASKQYQLEDCLVQGLVQTLD
    NCTC8325        HVHPQPFHLKQFAKQHQYTNAFYGPYQRPELTMFMDHIAHASKQYQLEDCLVQGLVQTLD
    Newman          HVHPQPFHLKQFAKQHQYTNAFYGPYQRPELTMFMDHIAHASKQYQLEDCLVQGLVQTLD
    USA300_FPR3757  HVHPQPFHLKQFAKQHQYTNAFYGPYQRPELTMFMDHIAHASKQYQLEDCLVQGLVQTLD
                    ***********************************:************************

    COL             KQEDKWHIKLEDGQIITTDCVVIAIGSTNIPFMPDILKDKQNVNHIFEKELDQVVYDKTD
    N315            KQEDKWHIKLEDGQIITTDCVVIAIGSTNIPFMPDILKDKQNVNHIFEKEHDQVVYDKTD
    NCTC8325        KQEDKWHIKLEDGQIITTDCVVIAIGSTNIPFMPDILKDKQNVNHIFEKELDQVVYDKTD
    Newman          KQEDKWHIKLEDGQIITTDCVVIAIGSTNIPFMPDILKDKQNVNHIFEKELDQVVYDKTD
    USA300_FPR3757  KQEDKWHIKLEDGQIITTDCVVIAIGSTNIPFMPDILKDKQNVNHIFEKELDQVVYDKTD
                    ************************************************** *********

    COL             HIVGSGITAAHLALKLLNHDNDKKIHLWLNKDIEIHDFDADPGWLGPKNMSSFLSTKSMP
    N315            HIVGSGITAAHLALKLLNHDNDKKIHLWLNKDIEIHDFDADPGWLGPKNMSSFLSTKSMP
    NCTC8325        HIVGSGITAAHLALKLLNHDNDKKIHLWLNKDIEIHDFDADPGWLGPKNMSSFLSTKSMP
    Newman          HIVGSGITAAHLALKLLNHDNDKKIHLWLNKDIEIHDFDADPGWLGPKNMSSFLSTKSMP
    USA300_FPR3757  HIVGSGITAAHLALKLLNHDNDKKIHLWLNKDIEIHDFDADPGWLGPKNMSSFLSTKSMP
                    ************************************************************

    COL             ERNAIVQRERHKGSMPHELYLRLKKHIKNGRINVHKTPITQISGGVINTENDSVPYQQIM
    N315            ERNAIVQRERHKGSMPHELYLRLKKHIKNGRINVHKTPITQISGGVINTENDSVPYQQIM
    NCTC8325        ERNAIVQRERHKGSMPHELYLRLKKHIKNGRINVHKTPITQISGGVINTENDSVPYQQIM
    Newman          ERNAIVQRERHKGSMPHELYLRLKKHIKNGRINVHKTPITQISGGVINTENDSVPYQQIM
    USA300_FPR3757  ERNAIVQRERHKGSMPHELYLRLKKHIKNGRINVHKTPITQISGGVINTENDSVPYQQIM
                    ************************************************************

    COL             VATGFEQDFMSQPLIKQLIQNYDAPINECNYPVISEKLEWIPNLFVAGCFADLELGPFGR
    N315            VATGFEQDFMSQPLIKQLIQNYDAPINECNYPVISEKLEWIPNLFVAGCFADLELGPFGR
    NCTC8325        VATGFEQDFMSQPLIKQLIQNYDAPINECNYPVISEKLEWIPNLFVAGCFADLELGPFGR
    Newman          VATGFEQDFMSQPLIKQLIQNYDAPINECNYPVISEKLEWIPNLFVAGCFADLELGPFGR
    USA300_FPR3757  VATGFEQDFMSQPLIKQLIQNYDAPINECNYPVISEKLEWIPNLFVAGCFADLELGPFGR
                    ************************************************************

    COL             NVMGGRKAAERIEQAFLKLQQYSA
    N315            NVMGGRKAAERIEQAFLKLQQYSA
    NCTC8325        NVMGGRKAAERIEQAFLKLQQYSA
    Newman          NVMGGRKAAERIEQAFLKLQQYSA
    USA300_FPR3757  NVMGGRKAAERIEQAFLKLQQYSA
                    ************************