Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003051000
  • symbol?: mnhC
  • description?: monovalent cation/H+ antiporter subunit C

      descriptions from strain specific annotations:

    • monovalent cation/H+ antiporter subunit C
    • putative monovalent cation/H+ antiporter subunit C
    • Na(+) H(+) antiporter subunit C
    • na(+)/H(+) antiporter subunit C (Multiple resistance and pHhomeostasis protein C) (Mrp complex subunit C)
    • Na(+)/H(+) antiporter subunit C
    • Na(+)/H(+) antiporter subunit C1
    • CPA3 family monovalent cation:proton (H+) antiporter-3 subunit C
    • Na+/H+ antiporter subunit
    • CPA3 family monovalent cation (K+ or Na+):proton (H+) antiporter-3 MnhC subunit
    • ShaC
    • monovalent cation antiporter-3 subunit C, MnhC
  • strand?: -
  • coordinates?: 3440903..3441157
  • synteny block?: BlockID0021590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0953 (mnhC)
    N315:
    SA0811 (mnhC)
    NCTC8325:
    Newman:
    NWMN_0820 (mnhC)
    USA300_FPR3757:
    04-02981:
    SA2981_0905 (mnhC)
    08BA02176:
    C248_0949 (mnhC)
    11819-97:
    MS7_0905
    71193:
    ST398NM01_0933
    ECT-R 2:
    ECTR2_806
    ED133:
    SAOV_0896c
    ED98:
    SAAV_0911 (mnhC)
    HO 5096 0412:
    SAEMRSA15_07800 (mnhC)
    JH1:
    SaurJH1_0969
    JH9:
    SaurJH9_0950
    JKD6008:
    SAA6008_00903 (mnhC)
    JKD6159:
    SAA6159_00809 (mnhC)
    LGA251:
    SARLGA251_08680 (MnhC1)
    M013:
    M013TW_0869
    MRSA252:
    SAR0912 (mnhC)
    MSHR1132:
    SAMSHR1132_08020
    MSSA476:
    SAS0820
    Mu3:
    SAHV_0945 (mnhC)
    Mu50:
    SAV0950 (mnhC)
    MW2:
    MW0832 (mnhC)
    RF122:
    SAB0817c (mnhC)
    ST398:
    SAPIG0933
    T0131:
    SAT0131_00982
    TCH60:
    HMPREF0772_12297 (mnhC)
    TW20:
    SATW20_09500 (MnhC1)
    USA300_TCH1516:
    USA300HOU_0910 (mnhC2)
    VC40:
    SAVC_03925

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------------------MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANL
    N315            -------------------MEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANL
    NCTC8325        -----------------------MIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANL
    Newman          MCSSWYCHDNYYFDWRERIVEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANL
    USA300_FPR3757  -----------------------MIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANL
                                           *************************************

    COL             FLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTD
    N315            FLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTD
    NCTC8325        FLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTD
    Newman          FLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTD
    USA300_FPR3757  FLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTD
                    ************************************************************

    COL             NVESMKGVPEDD
    N315            NVESMKGVPEDD
    NCTC8325        NVESMKGVPEDD
    Newman          NVESMKGVPEDD
    USA300_FPR3757  NVESMKGVPEDD
                    ************