From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003058000
  • symbol?:
  • description?: NADH-dependent flavin oxidoreductase

      descriptions from strain specific annotations:

    • NADH-dependent flavin oxidoreductase
    • NADH:flavin oxidoreductase
    • Oye family NADH-dependent flavin oxidoreductase
    • Putative NADH-dependent flavin oxidoreductase
    • NADH:flavin oxidoreductase / NADH oxidase family protein
    • FMN oxidoreductase
    • flavin reductase
  • strand?: +
  • coordinates?: 3447592..3448719
  • synteny block?: BlockID0021660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0911
    08BA02176:
    C248_0955
    11819-97:
    MS7_0911
    71193:
    ST398NM01_0939
    ECT-R 2:
    ECTR2_812
    ED133:
    SAOV_0902
    ED98:
    SAAV_0917
    HO 5096 0412:
    SAEMRSA15_07860
    JH1:
    SaurJH1_0975
    JH9:
    SaurJH9_0956
    JKD6008:
    SAA6008_00909
    JKD6159:
    SAA6159_00815
    LGA251:
    SARLGA251_08740
    M013:
    M013TW_0875
    MRSA252:
    SAR0918
    MSHR1132:
    SAMSHR1132_08080
    MSSA476:
    SAS0826
    Mu3:
    SAHV_0951
    Mu50:
    SAV0956
    MW2:
    MW0838
    RF122:
    SAB0823
    ST398:
    SAPIG0939
    T0131:
    SAT0131_00988 (cls)
    TCH60:
    HMPREF0772_12290 (namA)
    TW20:
    SATW20_09560
    USA300_TCH1516:
    USA300HOU_0915
    VC40:
    SAVC_03955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSKYEPLFDKVELPNGVELRNRFVLAPLTHISSNDDGTISDVELPYIEKRSQDVGITIN
    N315            MKSKYEPLFDKVELPNGVELRNRFVLAPLTHISSNDDGTISDVELPYIEKRSQDVGITIN
    NCTC8325        MKSKYEPLFDKVELPNGVELRNRFVLAPLTHISSNDDGTISDVELPYIEKRSQDVGITIN
    Newman          MKSKYEPLFDKVELPNGVELRNRFVLAPLTHISSNDDGTISDVELPYIEKRSQDVGITIN
    USA300_FPR3757  MKSKYEPLFDKVELPNGVELRNRFVLAPLTHISSNDDGTISDVELPYIEKRSQDVGITIN
                    ************************************************************

    COL             AASNVSDVGKAFPGQPSIAHDSNIEGLKRLATAMKKNGAKALVQIHHGGAQALPELTPDG
    N315            AASNVSDVGKAFPGQPSIAHDSDIEGLKRLATAMKKNGAKALVQIHHGGAQALPELIPDG
    NCTC8325        AASNVSDVGKAFPGQPSIAHDSNIEGLKRLATAMKKNGAKALVQIHHGGAQALPELTPDG
    Newman          AASNVSDVGKAFPGQPSIAHDSNIEGLKRLATAMKKNGAKALVQIHHGGAQALPELTPDG
    USA300_FPR3757  AASNVSDVGKAFPGQPSIAHDSNIEGLKRLATAMKKNGAKALVQIHHGGAQALPELTPDG
                    **********************:********************************* ***

    COL             DVVAPSPISLKSFGQKQEHSAREMTNEEIEQAIKDFGEATRRAIEAGFDGVEIHGANHYL
    N315            DVVAPSPISLKSFGQKQEHSAREMTNEEIEQAIKDFGEATRRAIEAGFDGVEIHGANHYL
    NCTC8325        DVVAPSPISLKSFGQKQEHSAREMTNEEIEQAIKDFGEATRRAIEAGFDGVEIHGANHYL
    Newman          DVVAPSPISLKSFGQKQEHSAREMTNEEIEQAIKDFGEATRRAIEAGFDGVEIHGANHYL
    USA300_FPR3757  DVVAPSPISLKSFGQKQEHSAREMTNEEIEQAIKDFGEATRRAIEAGFDGVEIHGANHYL
                    ************************************************************

    COL             IHQFVSPYYNRRNDVWANQYKFPVAVIEEVLKAKEAYGNKDFIVGYRLSPEEAESPGITM
    N315            IHQFVSPYYNRRNDVWANQYKFPVAVIEEVLKAKEAYGNKDFIVGYRLSPEEAESPGITM
    NCTC8325        IHQFVSPYYNRRNDVWANQYKFPVAVIEEVLKAKEAYGNKDFIVGYRLSPEEAESPGITM
    Newman          IHQFVSPYYNRRNDVWANQYKFPVAVIEEVLKAKEAYGNKDFIVGYRLSPEEAESPGITM
    USA300_FPR3757  IHQFVSPYYNRRNDVWANQYKFPVAVIEEVLKAKEAYGNKDFIVGYRLSPEEAESPGITM
                    ************************************************************

    COL             EITEELVNKISHMPIDYIHVSMMDTHATTREGKYAGQERLPLIHKWINGRMPLIGIGSIF
    N315            EITEELVNKISHMPIDYIHVSMMDTHATTREGKYAGQERLPLIHKWINGRMPLIGIGSIF
    NCTC8325        EITEELVNKISHMPIDYIHVSMMDTHATTREGKYAGQERLPLIHKWINGRMPLIGIGSIF
    Newman          EITEELVNKISHMPIDYIHVSMMDTHATTREGKYAGQERLPLIHKWINGRMPLIGIGSIF
    USA300_FPR3757  EITEELVNKISHMPIDYIHVSMMDTHATTREGKYAGQERLPLIHKWINGRMPLIGIGSIF
                    ************************************************************

    COL             TADEALDAVENVGVDLVAIGRELLLDYQFVEKIKDGREDEIINYFDPEREDNHHLTPNLW
    N315            TADEALDAVENVGVDLVAIGRELLLDYQFVEKIKDGREDEIINYFDPEREDNHHLTPNLW
    NCTC8325        TADEALDAVENVGVDLVAIGRELLLDYQFVEKIKDGREDEIINYFDPEREDNHHLTPNLW
    Newman          TADEALDAVENVGVDLVAIGRELLLDYQFVEKIKDGREDEIINYFDPEREDNHHLTPNLW
    USA300_FPR3757  TADEALDAVENVGVDLVAIGRELLLDYQFVEKIKDGREDEIINYFDPEREDNHHLTPNLW
                    ************************************************************

    COL             HQFNEGFYPLPRKDK
    N315            HQFNEGFYPLPRKDK
    NCTC8325        HQFNEGFYPLPRKDK
    Newman          HQFNEGFYPLPRKDK
    USA300_FPR3757  HQFNEGFYPLPRKDK
                    ***************