Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003076000
  • symbol?: addB
  • description?: ATP-dependent nuclease subunit B

      descriptions from strain specific annotations:

    • ATP-dependent nuclease subunit B
    • ATP-dependent nuclease subunit AddB
    • ATP-dependent nuclease, subunit B
    • exonuclease RexB
    • ATP-dependent nuclease Rex subunit B
    • ATP-dependent helicase/deoxyribonuclease subunit B
    • helicase-exonuclease AddAB, AddB subunit
  • strand?: +
  • coordinates?: 3460942..3464417
  • synteny block?: BlockID0021840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0970 (rexB)
    N315:
    NCTC8325:
    Newman:
    NWMN_0837 (rexB)
    USA300_FPR3757:
    04-02981:
    SA2981_0921
    08BA02176:
    C248_0968
    11819-97:
    MS7_0921 (addB)
    71193:
    ST398NM01_0949
    ECT-R 2:
    ECTR2_822 (addB)
    ED133:
    SAOV_0913
    ED98:
    SAAV_0927 (rexB)
    HO 5096 0412:
    SAEMRSA15_07960
    JH1:
    SaurJH1_0985
    JH9:
    SaurJH9_0966
    JKD6008:
    SAA6008_00919 (addB)
    JKD6159:
    SAA6159_00825 (addB)
    LGA251:
    SARLGA251_08840
    M013:
    M013TW_0885
    MRSA252:
    SAR0928
    MSHR1132:
    SAMSHR1132_08180
    MSSA476:
    SAS0836
    Mu3:
    SAHV_0961
    Mu50:
    SAV0966
    MW2:
    MW0848
    RF122:
    SAB0835
    ST398:
    SAPIG0949 (addB)
    T0131:
    SAT0131_00999
    TCH60:
    HMPREF0772_12280 (addB)
    TW20:
    SATW20_09660
    USA300_TCH1516:
    USA300HOU_0925 (rexB)
    VC40:
    SAVC_04005

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPELNGS
    N315            MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPELNGS
    NCTC8325        MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPELNGS
    Newman          MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPELNGS
    USA300_FPR3757  MTLHAYLGRAGTGKSTKMLTEIKQKMKADPLGDPIILIAPTQSTFQLEQAFVNDPELNGS
                    ************************************************************

    COL             LRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKYYGFS
    N315            LRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKYYGFS
    NCTC8325        LRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKYYGFS
    Newman          LRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKYYGFS
    USA300_FPR3757  LRTEVLHFERLSHRIFQEVGSYSEQKLSKAATEMMIYNIVQEQQKYLKLYQSQAKYYGFS
                    ************************************************************

    COL             EKLTEQIQDFKKYAVTPEHLEHFIADKNMQTRTKNKLEDIALIYREFEQRIQNEFITGED
    N315            EKLTEQIQDFKKYAVTPEHLEHFIADKNMQTRTKNKLEDIALIYREFEQRIQNEFITGED
    NCTC8325        EKLTEQIQDFKKYAVTPEHLEHFIADKNMQTRTKNKLEDIALIYREFEQRIQNEFITGED
    Newman          EKLTEQIQDFKKYAVTPEHLEHFIADKNMQTRTKNKLEDIALIYREFEQRIQNEFITGED
    USA300_FPR3757  EKLTEQIQDFKKYAVTPEHLEHFIADKNMQTRTKNKLEDIALIYREFEQRIQNEFITGED
                    ************************************************************

    COL             SLQYFIDCMPKSEWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSVTIILTTDGNHDQFS
    N315            SLQYFIDCMPKSEWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSVTIILTTDGNHDQFS
    NCTC8325        SLQYFIDCMPKSEWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSVTIILTTDGNHDQFS
    Newman          SLQYFIDCMPKSEWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSVTIILTTDGNHDQFS
    USA300_FPR3757  SLQYFIDCMPKSEWLKRADIYIDGFHNFSTIEYLIIKGLIKYAKSVTIILTTDGNHDQFS
                    ************************************************************

    COL             LFRKPSEVLRHIEEIANELNISIERQYFNQLYRFNNQDLKHLEQEFDALQINRVACQGHI
    N315            LFRKPSEVLRHIEEIANELNISIERQYFNQLYRFNNQDLKHLEQEFDVLQINRVACQGHI
    NCTC8325        LFRKPSEVLRHIEEIANELNISIERQYFNQLYRFNNQDLKHLEQEFDALQINRVACQGHI
    Newman          LFRKPSEVLRHIEEIANELNISIERQYFNQLYRFNNQDLKHLEQEFDALQINRVACQGHI
    USA300_FPR3757  LFRKPSEVLRHIEEIANELNISIERQYFNQLYRFNNQDLKHLEQEFDALQINRVACQGHI
                    ***********************************************.************

    COL             NILESATMREEINEIARRIIVDIRDKQLRYQDIAILYRDESYAYLFDSILPLYNIPYNID
    N315            NILESATMREEINEIARRIIVDIRDKQLRYQDIAILYRDESYAYLFDSILPLYNIPYNID
    NCTC8325        NILESATMREEINEIARRIIVDIRDKQLRYQDIAILYRDESYAYLFDSILPLYNIPYNID
    Newman          NILESATMREEINEIARRIIVDIRDKQLRYQDIAILYRDESYAYLFDSILPLYNIPYNID
    USA300_FPR3757  NILESATMREEINEIARRIIVDIRDKQLRYQDIAILYRDESYAYLFDSILPLYNIPYNID
                    ************************************************************

    COL             TKRSMTHHPVMEMIRSLIEVIQSNWQVNPMLRLLKTDVLTASYLKSAYLVDLLENFVLER
    N315            TKRSMTHHPVMEMIRSLIEVIQSNWQVNPMLRLLKTDVLTASYLKSAYLVDLLENFVLER
    NCTC8325        TKRSMTHHPVMEMIRSLIEVIQSNWQVNPMLRLLKTDVLTASYLKSAYLVDLLENFVLER
    Newman          TKRSMTHHPVMEMIRSLIEVIQSNWQVNPMLRLLKTDVLTASYLKSAYLVDLLENFVLER
    USA300_FPR3757  TKRSMTHHPVMEMIRSLIEVIQSNWQVNPMLRLLKTDVLTASYLKSAYLVDLLENFVLER
                    ************************************************************

    COL             GIYGKRWLDDELFNVEHFSKMGRKGHKLTEDERNTFEQVVKLKKDVIDKILHFEKQMSQA
    N315            GIYGKRWLDDELFNVEHFSKMGRKAHKLTEDERNTFEQVVKLKKDVIDKILHFEKQMSQA
    NCTC8325        GIYGKRWLDDELFNVEHFSKMGRKAHKLTEDERNTFEQVVKLKKDVIDKILHFEKQMSQA
    Newman          GIYGKRWLDDELFNVEHFSKMGRKGHKLTEDERNTFEQVVKLKKDVIDKILHFEKQMSQA
    USA300_FPR3757  GIYGKRWLDDELFNVEHFSKMGRKAHKLTEDERNTFEQVVKLKKDVIDKILHFEKQMSQA
                    ************************.***********************************

    COL             ETVKDFATAFYESMEYFELPNQLMTERDELDLNGNHEKAEEIDQIWNGLIQILDDLVLVF
    N315            ETVKDFATAFYESMEYFELPNQLMTERDELDLNGNHEKAEEIDQIWNGLIQILDDLVLVF
    NCTC8325        ETVKDFATAFYESMEYFELPNQLMTERDELDLNGNHEKAEEIDQIWNGLIQILDDLVLVF
    Newman          ETVKDFATAFYESMEYFELPNQLMTERDELDLNGNHEKAEEIDQIWNGLIQILDDLVLVF
    USA300_FPR3757  ETVKDFATAFYESMEYFELPNQLMTERDELDLNGNHEKAEEIDQIWNGLIQILDDLVLVF
                    ************************************************************

    COL             GDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAKVDNKQHVYLVGMNDGTMP
    N315            GDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAKVDNKQHVYLVGMNDGTMP
    NCTC8325        GDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAKVDNKQHVYLVGMNDGTMP
    Newman          GDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAKVDNKQHVYLVGMNDGTMP
    USA300_FPR3757  GDEPMSMERFLEVFDIGLEQLEFVMIPQTLDQVSIGTMDLAKVDNKQHVYLVGMNDGTMP
                    ************************************************************

    COL             QPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYVAMTRAKGDVTFSYSLMGS
    N315            QPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYVAMTRAKGDVTFSYSLMGS
    NCTC8325        QPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYVAMTRAKGDVTFSYSLMGS
    Newman          QPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYVAMTRAKGDVTFSYSLMGS
    USA300_FPR3757  QPVTASSLITDEEKKYFEQQANVELSPTSDILQMDEAFVCYVAMTRAKGDVTFSYSLMGS
                    ************************************************************

    COL             SGDDKEISPFLNQIQSLFNQLEITNIPQYHEVNPLSLMQHAKQTKITLFEALRAWLYDEI
    N315            SGDDKEISPFLNQIQSLFNQLEITNIPQYHEVNPLSLMQHAKQTKITLFEALRAWLDDEI
    NCTC8325        SGDDKEISPFLNQIQSLFNQLEITNIPQYHEVNPLSLMQHAKQTKITLFEALRAWLYDEI
    Newman          SGDDKEISPFLNQIQSLFNQLEITNIPQYHEVNPLSLMQHAKQTKITLFEALRAWLYDEI
    USA300_FPR3757  SGDDKEISPFLNQIQSLFNQLEITNIPQYHEVNPLSLMQHAKQTKITLFEALRAWLYDEI
                    ******************************************************** ***

    COL             VADSWLDAYQVIRDSDHLNQGLDYLMSALTFDNETVKLGETLSKDLYGKEINASVSRFEG
    N315            VADSWLDAYQVIRDSDHLNQGLDYLMSALTFDNETVKLGETLSKDLYGKEINASVSRFEG
    NCTC8325        VADSWLDAYQVIRDSDHLNQGLDYLMSALTFDNETVKLGETLSKDLYGKEINASVSRFEG
    Newman          VADSWLDAYQVIRDSDHLNQGLDYLMSALTFDNETVKLGETLSKDLYGKEINASVSRFEG
    USA300_FPR3757  VADSWLDAYQVIRDSDHLNQGLDYLMSALTFDNETVKLGETLSKDLYGKEINASVSRFEG
                    ************************************************************

    COL             YQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYISERINGDFKQLDLKKIRQLT
    N315            YQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYISERINGDFKQLDLKKIRQLT
    NCTC8325        YQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYISERINGDFKQLDLKKIRQLT
    Newman          YQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYISERINGDFKQLDLKKIRQLT
    USA300_FPR3757  YQQCPFKHYASHGLKLNERTKYELQNFDLGDIFHSVLKYISERINGDFKQLDLKKIRQLT
                    ************************************************************

    COL             NEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTLSALKYQGTYSKFMPKHFETSFRR
    N315            NEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTLSALKYQGTYSKFMPKHFETSFRR
    NCTC8325        NEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTLSALKYQGTYSKFMPKHFETSFRR
    Newman          NEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTLSALKYQGTYSKFMPKHFETSFRR
    USA300_FPR3757  NEALEEILPKVQFNLLNSSAYYRYLSRRIGAIVETTLSALKYQGTYSKFMPKHFETSFRR
                    ************************************************************

    COL             KPRTNDELIAQTLTTTQGIPINIRGQIDRIDTYTKNDTSFVNIIDYKSSEGSATLDLTKV
    N315            KPRTNDELIAQTLTTTQGIPINIRGQIDRIDTYTKNDTSFVNIIDYKSSEGSATLDLTKV
    NCTC8325        KPRTNDELIAQTLTTTQGIPINIRGQIDRIDTYTKNDTSFVNIIDYKSSEGSATLDLTKV
    Newman          KPRTNDELIAQTLTTTQGIPINIRGQIDRIDTYTKNDTSFVNIIDYKSSEGSATLDLTKV
    USA300_FPR3757  KPRTNDELIAQTLTTTQGIPINIRGQIDRIDTYTKNDTSFVNIIDYKSSEGSATLDLTKV
                    ************************************************************

    COL             YYGMQMQMMTYMDIVLQNKQRLGLTDIVKPGGLLYFHVHEPRIKFKSWSDIDEDKLEQDL
    N315            YYGMQMQMMTYMDIVLQNKQRLGLTDIVKPGGLLYFHVHEPRIKFKSWSDIDEDKLEQDL
    NCTC8325        YYGMQMQMMTYMDIVLQNKQRLGLTDIVKPGGLLYFHVHEPRIKFKSWSDIDEDKLEQDL
    Newman          YYGMQMQMMTYMDIVLQNKQRLGLTDIVKPGGLLYFHVHEPRIKFKSWSDIDEDKLEQDL
    USA300_FPR3757  YYGMQMQMMTYMDIVLQNKQRLGLTDIVKPGGLLYFHVHEPRIKFKSWSDIDEDKLEQDL
                    ************************************************************

    COL             IKKFKLSGLVNADQTVIDALDIRLEPKFTSDIVPVGLNKDGSLSKRGSQVADEATIYKFI
    N315            IKKFKLSGLVNADQTVIDALDIRLEPKFTSDIVPVGLNKDGSLSKRGSQVADEATIYKFI
    NCTC8325        IKKFKLSGLVNADQTVIDALDIRLEPKFTSDIVPVGLNKDGSLSKRGSQVADEATIYKFI
    Newman          IKKFKLSGLVNADQTVIDALDIRLEPKFTSDIVPVGLNKDGSLSKRGSQVADEATIYKFI
    USA300_FPR3757  IKKFKLSGLVNADQTVIDALDIRLEPKFTSDIVPVGLNKDGSLSKRGSQVADEATIYKFI
                    ************************************************************

    COL             QHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETIN
    N315            QHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETIN
    NCTC8325        QHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETIN
    Newman          QHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETIN
    USA300_FPR3757  QHNKENFIETASNIMDGHTEVAPLKYKQKLPCAFCSYQSVCHVDGMIDSKRYRTVDETIN
                    ************************************************************

    COL             PIEAIQNININDEFGGEQ
    N315            PIEAIQNININDEFGGE-
    NCTC8325        PIEAIQNININDEFGGEQ
    Newman          PIEAIQNININDEFGGEQ
    USA300_FPR3757  PIEAIQNININDEFGGEQ
                    *****************