From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003078000
  • symbol?:
  • description?: 5-oxo-1,2,5-tricarboxilic-3-penten acid decarboxylase

      descriptions from strain specific annotations:

    • 5-oxo-1,2,5-tricarboxilic-3-penten acid decarboxylase
    • fumarylacetoacetate (FAA) hydrolase family protein
    • 5-carboxymethyl-2-hydroxymuconate delta-isomerase
    • fumarylacetoacetate hydrolase family protein
    • fumarylacetoacetase
    • 2-keto-4-pentenoate hydratase
  • strand?: +
  • coordinates?: 3468240..3469142
  • synteny block?: BlockID0021860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0923
    08BA02176:
    C248_0970
    11819-97:
    MS7_0923
    71193:
    ST398NM01_0951
    ECT-R 2:
    ECTR2_824
    ED133:
    SAOV_0915
    ED98:
    SAAV_0929
    HO 5096 0412:
    SAEMRSA15_07980
    JH1:
    SaurJH1_0987
    JH9:
    SaurJH9_0968
    JKD6008:
    SAA6008_00921 (mhpD)
    JKD6159:
    SAA6159_00827 (mhpD)
    LGA251:
    SARLGA251_08860
    M013:
    M013TW_0887
    MRSA252:
    SAR0930
    MSHR1132:
    SAMSHR1132_08200
    MSSA476:
    SAS0838
    Mu3:
    SAHV_0963
    Mu50:
    SAV0968
    MW2:
    MW0850
    RF122:
    SAB0837
    ST398:
    SAPIG0951
    T0131:
    SAT0131_01001
    TCH60:
    HMPREF0772_12278 (fahA)
    TW20:
    SATW20_09680
    USA300_TCH1516:
    USA300HOU_0927
    VC40:
    SAVC_04015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFLSFKYNDKTSYGVKVKREDAVWDLTQVFADFAEGDFHPKTLLAGLQQNHTLDFQEQV
    N315            MKFLSFKYNDKTSYGVKVKREDAVWDLTQVFADFAEGDFHPKTLLAGLQQNHTLDFQEQV
    NCTC8325        MKFLSFKYNDKTSYGVKVKREDAVWDLTQVFADFAEGDFHPKTLLAGLQQNHTLDFQEQV
    Newman          MKFLSFKYNDKTSYGVKVKREDAVWDLTQVFADFAEGDFHPKTLLAGLQQNHTLDFQEQV
    USA300_FPR3757  MKFLSFKYNDKTSYGVKVKREDAVWDLTQVFADFAEGDFHPKTLLAGLQQNHTLDFQEQV
                    ************************************************************

    COL             RKAVVAAEDSGKAEDYKISFNDIEFLPPVTPPNNVIAFGRNYKDHANELNHEVEKLYVFT
    N315            RKAVVAAEDSGKAEDYKISFNDIEFLPPVTPPNNVIAFGRNYKDHANELNHEVEKLYVFT
    NCTC8325        RKAVVAAEDSGKAEDYKISFNDIEFLPPVTPPNNVIAFGRNYKDHANELNHEVEKLYVFT
    Newman          RKAVVAAEDSGKAEDYKISFNDIEFLPPVTPPNNVIAFGRNYKDHANELNHEVEKLYVFT
    USA300_FPR3757  RKAVVAAEDSGKAEDYKISFNDIEFLPPVTPPNNVIAFGRNYKDHANELNHEVEKLYVFT
                    ************************************************************

    COL             KAASSLTGDNATIPNHKDITDQLDYEGELGIVIGKSGEKIPKALALDYVYGYTIINDITD
    N315            KAASSLTGDNATIPNHKDITDQLDYEGELGIVIGKSGEKIPKALALDYVYGYTIINDITD
    NCTC8325        KAASSLTGDNATIPNHKDITDQLDYEGELGIVIGKSGEKIPKALALDYVYGYTIINDITD
    Newman          KAASSLTGDNATIPNHKDITDQLDYEGELGIVIGKSGEKIPKALALDYVYGYTIINDITD
    USA300_FPR3757  KAASSLTGDNATIPNHKDITDQLDYEGELGIVIGKSGEKIPKALALDYVYGYTIINDITD
                    ************************************************************

    COL             RKAQSEQDQAFLSKSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILK
    N315            RKAQSEQDQAFLSKSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILK
    NCTC8325        RKAQSEQDQAFLSKSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILK
    Newman          RKAQSEQDQAFLSKSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILK
    USA300_FPR3757  RKAQSEQDQAFLSKSLTGGCPMGPYIVTKDELPLPENVNIVTKVNNEIRQDGNTGEMILK
                    ************************************************************

    COL             IDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYIAK
    N315            IDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYIAK
    NCTC8325        IDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYIAK
    Newman          IDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYIAK
    USA300_FPR3757  IDELIEEISKYVALHPGDIIATGTPAGVGAGMQPPKFLQPGDEVKVTIDNIGTLTTYIAK
                    ************************************************************