From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003113000
  • symbol?: clpB
  • description?: chaperone protein ClpB

      descriptions from strain specific annotations:

    • chaperone protein ClpB
    • ATP-dependent Clp protease, ATP-binding subunit ClpB
    • ATP-dependent Clp protease ATP-binding subunit ClpB
    • chaperone clpB
    • ATPase
    • ATPase of an ATP-dependent protease
    • ATPase subunit of an ATP-dependent protease, ClpB
    • ATP-dependent chaperone ClpB
    • ATP-dependent chaperone protein ClpB
    • ClpB chaperone homologue
    • ClpB chaperone-like protein
    • ClpB protein
    • endopeptidase ClpB
    • putative ATPase subunit of an ATP-dependent protease
    • putative ATP-dependent protease protein
  • strand?: +
  • coordinates?: 3498217..3500867
  • synteny block?: BlockID0022060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0979 (clpB)
    N315:
    SA0835 (clpB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0930 (clpB)
    08BA02176:
    C248_1001 (clpB)
    11819-97:
    MS7_0930 (clpB)
    71193:
    ST398NM01_0974
    ECT-R 2:
    ECTR2_830 (clpB)
    ED133:
    SAOV_0921
    ED98:
    SAAV_0935 (clpB)
    HO 5096 0412:
    SAEMRSA15_08040 (clpB)
    JH1:
    SaurJH1_0993
    JH9:
    SaurJH9_0974
    JKD6008:
    SAA6008_00927 (clpB)
    JKD6159:
    SAA6159_00834 (clpB)
    LGA251:
    SARLGA251_08920 (clpB)
    M013:
    M013TW_0893
    MRSA252:
    SAR0938 (clpB)
    MSHR1132:
    SAMSHR1132_08260
    MSSA476:
    SAS0845
    Mu3:
    SAHV_0970 (clpB)
    Mu50:
    SAV0975 (clpB)
    MW2:
    MW0857 (clpB)
    RF122:
    SAB0843 (clpB)
    ST398:
    SAPIG0974 (clpB)
    T0131:
    SAT0131_01008 (atpC)
    TCH60:
    HMPREF0772_12271 (clpB)
    TW20:
    SATW20_09740 (clpB)
    USA300_TCH1516:
    USA300HOU_0933 (clpB)
    VC40:
    SAVC_04045

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDINKMTYAVQSALQQAVELSQQHKLQNIEIEAILSAALNESESLYKSILERANIEVDQL
    N315            MDINKMTYAVQSALQQAVELSQQHKLQNIEIEAILSAALNESESLYKSILERANIEVDQL
    NCTC8325        MDINKMTYAVQSALQQAVELSQQHKLQNIEIEAILSAALNESESLYKSILERVNIEVDQL
    Newman          MDINKMTYAVQSALQQAVELSQQHKLQNIEIEAILSAALNESESLYKSILERANIEVDQL
    USA300_FPR3757  MDINKMTYAVQSALQQAVELSQQHKLQNIEIEAILSAALNESESLYKSILERANIEVDQL
                    ****************************************************.*******

    COL             NKAYEDKLNTYASVEGDNIQYGQYISQQANQLITKAESYMKEYEDEYISMEHILRSAMDI
    N315            NKAYEDKLNTYASVEGDNIQYGQYISQQANQLITKAESYMKEYEDEYISMEHILRSAMDI
    NCTC8325        NKAYEDKLNTYASVEGDNIQYGQYISQQANQLITKAESYMKEYEDEYISMEHILRSAMDI
    Newman          NKAYEDKLNTYASVEGDNIQYGQYISQQANQLITKAESYMKEYEDEYISMEHILRSAMDI
    USA300_FPR3757  NKAYEDKLNTYASVEGDNIQYGQYISQQANQLITKAESYMKEYEDEYISMEHILRSAMDI
                    ************************************************************

    COL             DQTTKHYINNKVEVIKEIIKKVRGGNHVTSQNPEVNYEALAKYGRDLVEEVRQGKMDPVI
    N315            DQTTKHYINNKVEVIKEIIKKVRGGNHVTSQNPEVNYEALAKYGRDLVEEVRQGKMDPVI
    NCTC8325        DQTTKHYINNKVEVIKEIIKKVRGGNHVTSQNPEVNYEALAKYGRDLVEEVRQGKMDPVI
    Newman          DQTTKHYINNKVEVIKEIIKKVRGGNHVTSQNPEVNYEALAKYGRDLVEEVRQGKMDPVI
    USA300_FPR3757  DQTTKHYINNKVEVIKEIIKKVRGGNHVTSQNPEVNYEALAKYGRDLVEEVRQGKMDPVI
                    ************************************************************

    COL             GRDEEIRNTIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQRIVKKDVPESLLDKTVFELD
    N315            GRDEEIRNTIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQRIVKKDVPESLLDKTVFELD
    NCTC8325        GRDEEIRNTIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQRIVKKDVPESLLDKTVFELD
    Newman          GRDEEIRNTIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQRIVKKDVPESLLDKTVFELD
    USA300_FPR3757  GRDEEIRNTIRILSRKTKNNPVLIGEPGVGKTAIVEGLAQRIVKKDVPESLLDKTVFELD
                    ************************************************************

    COL             LSALVAGAKYRGEFEERLKAVLKEVKESDGRIILFIDEIHMLVGAGKTDGAMDAGNMLKP
    N315            LSALVAGAKYRGEFEERLKAVLKEVKESDGRIILFIDEIHMLVGAGKTDGAMDAGNMLKP
    NCTC8325        LSALVAGAKYRGEFEERLKAVLKEVKESDGRIILFIDEIHMLVGAGKTDGAMDAGNMLKP
    Newman          LSALVAGAKYRGEFEERLKAVLKEVKESDGRIILFIDEIHMLVGAGKTDGAMDAGNMLKP
    USA300_FPR3757  LSALVAGAKYRGEFEERLKAVLKEVKESDGRIILFIDEIHMLVGAGKTDGAMDAGNMLKP
                    ************************************************************

    COL             MLARGELHCIGATTLNEYREYIEKDSALERRFQKVAVSEPDVEDTISILRGLKERYEVYH
    N315            MLARGELHCIGATTLNEYREYIEKDSALERRFQKVAVSEPDVEDTISILRGLKERYEVYH
    NCTC8325        MLARGELHCIGATTLNEYREYIEKDSALERRFQKVAVSEPDVEDTISILRGLKERYEVYH
    Newman          MLARGELHCIGATTLNEYREYIEKDSALERRFQKVAVSEPDVEDTISILRGLKERYEVYH
    USA300_FPR3757  MLARGELHCIGATTLNEYREYIEKDSALERRFQKVAVSEPDVEDTISILRGLKERYEVYH
                    ************************************************************

    COL             GVRIQDRALVAAAELSDRYITDRFLPDKAIDLVDQACATIRTEMGSNPTELDQVNRRVMQ
    N315            GVRIQDRALVAAAELSDRYITDRFLPDKAIDLVDQACATIRTEMGSNPTELDQVNRRVMQ
    NCTC8325        GVRIQDRALVAAAELSDRYITDRFLPDKAIDLVDQACATIRTEMGSNPTELDQVNRRVMQ
    Newman          GVRIQDRALVAAAELSDRYITDRFLPDKAIDLVDQACATIRTEMGSNPTELDQVNRRVMQ
    USA300_FPR3757  GVRIQDRALVAAAELSDRYITDRFLPDKAIDLVDQACATIRTEMGSNPTELDQVNRRVMQ
                    ************************************************************

    COL             LEIEESALKNESDNASKQRLQELQEELANEKEKQAALQSRVESEKEKIANLQEKRAQLDE
    N315            LEIEESALKNESDNASKQRLQELQEELANEKEKQAALQSRVESEKEKIANLQEKRAQLDE
    NCTC8325        LEIEESALKNESDNASKQRLQELQEELANEKEKQAALQSRVESEKEKIANLQEKRAQLDE
    Newman          LEIEESALKNESDNASKQRLQELQEELANEKEKQAALQSRVESEKEKIANLQEKRAQLDE
    USA300_FPR3757  LEIEESALKNESDNASKQRLQELQEELANEKEKQAALQSRVESEKEKIANLQEKRAQLDE
                    ************************************************************

    COL             SRQALEDAQTNNNLEKAAELQYGTIPQLEKELRELEDNFQDEQGEDTDRMIREVVTDEEI
    N315            SRQALEDAQTNNNLEKAAELQYGTIPQLEKELRELEDNFQDEQGEDTDRMIREVVTDEEI
    NCTC8325        SRQALEDAQTNNNLEKAAELQYGTIPQLEKELRELEDNFQDEQGEDTDRMIREVVTDEEI
    Newman          SRQALEDAQTNNNLEKAAELQYGTIPQLEKELRELEDNFQDEQGEDTDRMIREVVTDEEI
    USA300_FPR3757  SRQALEDAQTNNNLEKAAELQYGTIPQLEKELRELEDNFQDEQGEDTDRMIREVVTDEEI
                    ************************************************************

    COL             GDIVSQWTGIPVSKLVETEREKLLHLSDILHKRVVGQDKAVDLVSDAVVRARAGIKDPNR
    N315            GDIVSQWTGIPVSKLVETEREKLLHLSDILHKRVVGQDKAVDLVSDAVVRARAGIKDPNR
    NCTC8325        GDIVSQWTGIPVSKLVETEREKLLHLSDILHKRVVGQDKAVDLVSDAVVRARAGIKDPNR
    Newman          GDIVSQWTGIPVSKLVETEREKLLHLSDILHKRVVGQDKAVDLVSDAVVRARAGIKDPNR
    USA300_FPR3757  GDIVSQWTGIPVSKLVETEREKLLHLSDILHKRVVGQDKAVDLVSDAVVRARAGIKDPNR
                    ************************************************************

    COL             PIGSFLFLGPTGVGKTELAKSLAASLFDSEKHMIRIDMSEYMEKHAVSRLIGAPPGYIGH
    N315            PIGSFLFLGPTGVGKTELAKSLAASLFDSEKHMIRIDMSEYMEKHAVSRLIGAPPGYIGH
    NCTC8325        PIGSFLFLGPTGVGKTELAKSLAASLFDSEKHMIRIDMSEYMEKHAVSRLIGAPPGYIGH
    Newman          PIGSFLFLGPTGVGKTELAKSLAASLFDSEKHMIRIDMSEYMEKHAVSRLIGAPPGYIGH
    USA300_FPR3757  PIGSFLFLGPTGVGKTELAKSLAASLFDSEKHMIRIDMSEYMEKHAVSRLIGAPPGYIGH
                    ************************************************************

    COL             DEGGQLTEAVRRNPYSVILLDEVEKAHTDVFNVLLQILDEGRLTDSKGRSVDFKNTIIIM
    N315            DEGGQLTEAVRRNPYSVILLDEVEKAHTDVFNVLLQILDEGRLTDSKGRSVDFKNTIIIM
    NCTC8325        DEGGQLTEAVRRNPYSVILLDEVEKAHTDVFNVLLQILDEGRLTDSKGRSVDFKNTIIIM
    Newman          DEGGQLTEAVRRNPYSVILLDEVEKAHTDVFNVLLQILDEGRLTDSKGRSVDFKNTIIIM
    USA300_FPR3757  DEGGQLTEAVRRNPYSVILLDEVEKAHTDVFNVLLQILDEGRLTDSKGRSVDFKNTIIIM
                    ************************************************************

    COL             TSNIGSQVLLENVKETGEITESTEKAVMTSLNAYFKPEILNRMDDIVLFKPLSIDDMSMI
    N315            TSNIGSQVLLENVKETGEITESTEKAVMTNLNAYFKPEILNRMDDIVLFKPLSIDDMSMI
    NCTC8325        TSNIGSQVLLENVKETGEITESTEKAVMTSLNAYFKPEILNRMDDIVLFKPLSIDDMSMI
    Newman          TSNIGSQVLLENVKETGEITESTEKAVMTSLNAYFKPEILNRMDDIVLFKPLSIDDMSMI
    USA300_FPR3757  TSNIGSQVLLENVKETGEITESTEKAVMTSLNAYFKPEILNRMDDIVLFKPLSIDDMSMI
                    *****************************.******************************

    COL             VDKILTQLNIRLLEQRISIEVSDDAKAWLGQEAYEPQYGARPLKRFVQRQIETPLARMMI
    N315            VDKILTQLNIRLLEQRISIEVSDDAKAWLGQEAYEPQYGARPLKRFVQRQIETPLARMMI
    NCTC8325        VDKILTQLNIRLLEQRISIEVSDDAKAWLGQEAYEPQYGARPLKRFVQRQIETPLARMMI
    Newman          VDKILTQLNIRLLEQRISIEVSDDAKAWLGQEAYEPQYGARPLKRFVQRQIETPLARMMI
    USA300_FPR3757  VDKILTQLNIRLLEQRISIEVSDDAKAWLGQEAYEPQYGARPLKRFVQRQIETPLARMMI
                    ************************************************************

    COL             KEGFPEGTTIKVNLNSDNNLTFNVEKIHE
    N315            KEGFPEGTTIKVNLNSDNNLTFNVEKIHE
    NCTC8325        KEGFPEGTTIKVNLNSDNNLTFNVEKIHE
    Newman          KEGFPEGTTIKVNLNSDNNLTFNVEKIHE
    USA300_FPR3757  KEGFPEGTTIKVNLNSDNNLTFNVEKIHE
                    *****************************