From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003116000
  • symbol?:
  • description?: 2-isopropylmalate synthase

      descriptions from strain specific annotations:

    • 2-isopropylmalate synthase
    • isopropylmalate synthase-like protein
    • 2-isopropylmalate synthase, putative
    • HMGL-like family protein
    • isopropylmalate synthase-related protein
    • pseudogene
  • strand?: +
  • coordinates?: 3501937..3503083
  • synteny block?: BlockID0022090
  • occurrence?: in 78% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0932
    08BA02176:
    11819-97:
    MS7_0932
    71193:
    ECT-R 2:
    ECTR2_832
    ED133:
    SAOV_0923
    ED98:
    SAAV_0937
    HO 5096 0412:
    SAEMRSA15_08060
    JH1:
    SaurJH1_0995
    JH9:
    SaurJH9_0976
    JKD6008:
    SAA6008_00929 (leuA1)
    JKD6159:
    LGA251:
    SARLGA251_08940
    M013:
    MRSA252:
    SAR0940
    MSHR1132:
    MSSA476:
    SAS0847
    Mu3:
    SAHV_0972
    Mu50:
    SAV0977
    MW2:
    MW0859
    RF122:
    ST398:
    T0131:
    SAT0131_01010 (atpD)
    TCH60:
    HMPREF0772_12268 (leuA2)
    TW20:
    SATW20_09760
    USA300_TCH1516:
    USA300HOU_0935 (leuA1)
    VC40:
    SAVC_04055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIRIQDNTIRDGMQQSNVRKSLIIKKEVLKQINKLNINSVEVGMCTTIEDEFNIHQFRDI
    N315            MIRIQDNTIRDGMQQSNVRKSLIIKKEVLKQINKLNINSVEVGMCTTIEDEFNIHQFRDI
    NCTC8325        MIRIQDNTIRDGMQQSNVRKSLIIKKEVLKQINKLNINSVEVGMCTTIEDEFNIHQFRDI
    Newman          MIRIQDNTIRDGMQQSNVRKSLIIKKEVLKQINKLNINSVEVGMCTTIEDEFNIHQFRDI
    USA300_FPR3757  MIRIQDNTIRDGMQQSNVRKSLIIKKEVLKQINKLNINSVEVGMCTTIEDEFNIHQFRDI
                    ************************************************************

    COL             ISPEKELVVLTRLNEKEIKKIVKLKIHNLVVKILLPISDLHIKEKLNFSNKYYIQKIKDC
    N315            LSPEKELVVLTRLNEKEIKKIVKLKIHNLVVKILLPISDLHIKEKLNFSNKYYIQKIKDC
    NCTC8325        LSPEKELVVLTRLNEKEIKKIVKLKIHNLVVKILLPISDLHIKEKLNFSNKYYIQKIKDC
    Newman          LSPEKELVVLTRLNEKEIKKIVKLKIHNLVVKILLPISDLHIKEKLNFSNKYYIQKIKDC
    USA300_FPR3757  LSPEKELVVLTRLNEKEIKKIVKLKIHNLVVKILLPISDLHIKEKLNFSNKYYIQKIKDC
                    :***********************************************************

    COL             LDILKKDKKGVDICFEDGTRTSREKLKEYMEIISKYQVRTVTFADTVGCSTPLEYGDIFN
    N315            LDILKKDKKGVDICFEDATRTSREKLKEYMEIISKYQVRTVTFADTVGCSTPLEYGDIFN
    NCTC8325        LDILKKDKKGVDICFEDGTRTSREKLKEYMEIISKYQVRTVTFADTVGCSTPLEYGDIFN
    Newman          LDILKKDKKGVDICFEDGTRTSREKLKEYMEIISKYQVRTVTFADTVGCSTPLEYGDIFN
    USA300_FPR3757  LDILKKDKKGVDICFEDGTRTSREKLKEYMEIISKYQVRTVTFADTVGCSTPLEYGDIFN
                    *****************.******************************************

    COL             YFVKKYSNIIFSAHCHNDLGLATANTLAAILNGAKQIETTFLGIGERAGNAPIEEIITIL
    N315            YFVKKYSNIIFSAHCHNDLGLATANTLAAILNGAKQIETTFLGIGERAGNAPIEEIITIL
    NCTC8325        YFVKKYSNIIFSAHCHNDLGLATANTLAAILNGAKQIETTFLGIGERAGNAPIEEIITIL
    Newman          YFVKKYSNIIFSAHCHNDLGLATANTLAAILNGAKQIETTFLGIGERAGNAPIEEIITIL
    USA300_FPR3757  YFVKKYSNIIFSAHCHNDLGLATANTLAAILNGAKQIETTFLRIGERAGNAPIEEIITIL
                    ****************************************** *****************

    COL             TKKQIESTEFTLPDVYKTSINISKILDFQISENKPIIGENIFKHESGIHQDGTKKNINMY
    N315            TKKQIESTEFTLPDVYKTSINISKILDFQISENKPIIGENIFKHESGIHQDGTKKNINMY
    NCTC8325        TKKQIESTEFTLPDVYKTSINISKILDFQISENKPIIGENIFKHESGIHQDGTKKNINMY
    Newman          TKKQIESTEFTLPDVYKTSINISKILDFQISENKPIIGENIFKHESGIHQDGTKKNINMY
    USA300_FPR3757  TKKQIESTEFTLPDVYKTSINISKILDFQISENKPIIGENIFKHESGIHQDGTKKNINMY
                    ************************************************************

    COL             QYLVPSDLGLKNSQVVQFPISNISSKKILHNKFKSIVNTEEIDENISFYKLVNKFSPEVA
    N315            QYLVPSDLGLKNSQVVQFPISNISSKKILHNKFKSIVNTEEIDENISFYKLVNKFSPEVA
    NCTC8325        QYLVPSDLGLKNSQVVQFPISNISSKKILHNKFKSIVNTEEIDENISFYKLVNKFSPEVA
    Newman          QYLVPSDLGLKNSQVVQFPISNISSKKILHNKFKSIVNTEEIDENISFYKLVNKFSPEVA
    USA300_FPR3757  QYLVPSDLGLKNSQVVQFPISNISSKKILHNKFKSIVNTEEIDENISFYKLVNKFSPEVA
                    ************************************************************

    COL             PEDTVDLLQIIKRRSKDGNFK
    N315            PEDTVDLLQIIKRRSKDGNFK
    NCTC8325        PEDTVDLLQIIKRRSKDGNFK
    Newman          PEDTVDLLQIIKRRSKDGNFK
    USA300_FPR3757  PEDTVDLLQIIKRRSKDGNFK
                    *********************