From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003124000
  • symbol?:
  • description?: MAP domain-containing protein

      descriptions from strain specific annotations:

    • MAP domain-containing protein
    • surface protein, putative
    • cell surface like-protein Map-w
    • map-ND2C domain protein
    • putative surface protein
    • truncated MHC class II analog protein
    • extracellular adherence protein Eap
    • putative cell surface protein , Map-w-like protein
    • truncated cell surface protein map-W
    • outer membrane protein
  • strand?: +
  • coordinates?: 3508967..3509401
  • synteny block?: BlockID0022160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0936
    08BA02176:
    C248_1004
    11819-97:
    MS7_0936
    71193:
    ST398NM01_0977
    ECT-R 2:
    ECTR2_836
    ED133:
    SAOV_0927
    ED98:
    SAAV_0942
    HO 5096 0412:
    SAEMRSA15_08100
    JH1:
    SaurJH1_0999
    JH9:
    SaurJH9_0980
    JKD6008:
    SAA6008_00934 (eap)
    JKD6159:
    SAA6159_00837 (eap)
    LGA251:
    SARLGA251_08980
    M013:
    M013TW_0903
    MRSA252:
    SAR0944
    MSHR1132:
    SAMSHR1132_08290
    MSSA476:
    SAS0851
    Mu3:
    SAHV_0976
    Mu50:
    SAV0981
    MW2:
    MW0863
    RF122:
    SAB0846
    ST398:
    SAPIG0977
    T0131:
    SAT0131_01014 (atpF)
    TCH60:
    HMPREF0772_12264
    TW20:
    SATW20_09800
    USA300_TCH1516:
    USA300HOU_0939 (eap)
    VC40:
    SAVC_04075

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLKSFITVTLALGMIATTGATVAGNEVSAAEKDKLPATQKAKEMQNVPYTIAVDGIMAF
    N315            MKLKSFITVTLALGMIATTGATVTSNEVSAAEKDKLPATQKAKEMQNVPYTIAVDGIMAF
    NCTC8325        MKLKSFITVTLALGMIATTGATVAGNEVSAAEKDKLPATQKAKEMQNVPYTIAVDGIMAF
    Newman          MKLKSFITVTLALGMIATTGATVAGNEVSAAEKDKLPATQKAKEMQNVPYTIAVDGIMAF
    USA300_FPR3757  MKLKSFITVTLALGMIATTGATVAGNEVSAAEKDKLPATQKAKEMQNVPYTIAVDGIMAF
                    ***********************:.***********************************

    COL             NQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLK
    N315            NQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLK
    NCTC8325        NQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLK
    Newman          NQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLK
    USA300_FPR3757  NQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLK
                    ************************************************************

    COL             KDSYTANLFDSNSIKQIDINVKTK
    N315            KDSYTANLFDSNSIKQIDINVKTK
    NCTC8325        KDSYTANLFDSNSIKQIDINVKTK
    Newman          KDSYTANLFDSNSIKQIDINVKTK
    USA300_FPR3757  KDSYTANLFDSNSIKQIDINVKTK
                    ************************