From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003128000
  • symbol?: fabF
  • description?: 3-oxoacyl-ACP synthase

      descriptions from strain specific annotations:

    • 3-oxoacyl-ACP synthase
    • Beta-ketoacyl synthase-like protein
    • 3-oxoacyl-[acyl-carrier-protein] synthase, KASII
    • 3-oxoacyl-ACP synthase II
    • 3-oxoacyl- synthase ,KASII
    • 3-oxoacyl-[acyl-carrier-protein] synthase 2
    • 3-oxoacyl-(acyl carrier protein) synthase II
    • beta-ketoacyl-acyl-carrier-protein synthase II
  • strand?: +
  • coordinates?: 3511111..3512355
  • synteny block?: BlockID0022200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0988 (fabF)
    N315:
    SA0843 (fab)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0939
    08BA02176:
    C248_1007 (fabF)
    11819-97:
    MS7_0939 (fabF)
    71193:
    ST398NM01_0980
    ECT-R 2:
    ECTR2_839 (fabF)
    ED133:
    SAOV_0930
    ED98:
    SAAV_0945 (fabF)
    HO 5096 0412:
    SAEMRSA15_08130 (fabF)
    JH1:
    SaurJH1_1002
    JH9:
    SaurJH9_0983
    JKD6008:
    SAA6008_00937 (fabB)
    JKD6159:
    SAA6159_00840 (fabB)
    LGA251:
    SARLGA251_09010 (fabF)
    M013:
    M013TW_0906
    MRSA252:
    SAR0947 (fabF)
    MSHR1132:
    SAMSHR1132_08320
    MSSA476:
    SAS0854
    Mu3:
    SAHV_0979
    Mu50:
    SAV0984
    MW2:
    MW0866 (fab)
    RF122:
    SAB0849 (fabF)
    ST398:
    SAPIG0980 (fabF)
    T0131:
    SAT0131_01017 (atpB)
    TCH60:
    HMPREF0772_12261 (fabF)
    TW20:
    SATW20_09830 (fabF)
    USA300_TCH1516:
    USA300HOU_0942 (fabH2)
    VC40:
    SAVC_04090

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQNKRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKNFNI
    N315            MSQNKRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKNFNI
    NCTC8325        MSQNKRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKNFNI
    Newman          MSQNKRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKNFNI
    USA300_FPR3757  MSQNKRVVITGMGALSPIGNDVKTTWENALKGVNGIDKITRIDTEPYSVHLAGELKNFNI
                    ************************************************************

    COL             EDHIDKKEARRMDRFTQYAIVAAREAVKDAQLDINENTADRIGVWIGSGIGGMETFEIAH
    N315            EDHIDKKEARRMDRFTQYAIVAAREAVKDAQLDINDNTADRIGVWIGSGIGGMETFEIAH
    NCTC8325        EDHIDKKEARRMDRFTQYAIVAAREAVKDAQLDINENTADRIGVWIGSGIGGMETFEIAH
    Newman          EDHIDKKEARRMDRFTQYAIVAAREAVKDAQLDINENTADRIGVWIGSGIGGMETFEIAH
    USA300_FPR3757  EDHIDKKEARRMDRFTQYAIVAAREAVKDAQLDINENTADRIGVWIGSGIGGMETFEIAH
                    ***********************************:************************

    COL             KQLMDKGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQ
    N315            KQLMDKGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQ
    NCTC8325        KQLMDKGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQ
    Newman          KQLMDKGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQ
    USA300_FPR3757  KQLMDKGPRRVSPFFVPMLIPDMATGQVSIDLGAKGPNGATVTACATGTNSIGEAFKIVQ
                    ************************************************************

    COL             RGDADAMITGGTEAPITHMAIAGFSASRALSTNDDIETACRPFQEGRDGFVMGEGAGILV
    N315            RGDADAMITGGTEAPITHMAIAGFSASRALSTNDDIETACRPFQEGRDGFVMGEGAGILV
    NCTC8325        RGDADAMITGGTEAPITHMAIAGFSASRALSTNDDIETACRPFQEGRDGFVMGEGAGILV
    Newman          RGDADAMITGGTEAPITHMAIAGFSASRALSTNDDIETACRPFQEGRDGFVMGEGAGILV
    USA300_FPR3757  RGDADAMITGGTEAPITHMAIAGFSASRALSTNDDIETACRPFQEGRDGFVMGEGAGILV
                    ************************************************************

    COL             IESLESAQARGANIYAEIVGYGTTGDAYHITAPAPEGEGGSRAMQAAMDDAGIEPKDVQY
    N315            IESLESAQARGANIYAEIVGYGTTGDAYHITAPAPEGEGGSRAMQAAMDDAGIEPKDVQY
    NCTC8325        IESLESAQARGANIYAEIVGYGTTGDAYHITAPAPEGEGGSRAMQAAMDDAGIEPKDVQY
    Newman          IESLESAQARGANIYAEIVGYGTTGDAYHITAPAPEGEGGSRAMQAAMDDAGIEPKDVQY
    USA300_FPR3757  IESLESAQARGANIYAEIVGYGTTGDAYHITAPAPEGEGGSRAMQAAMDDAGIEPKDVQY
                    ************************************************************

    COL             LNAHGTSTPVGDLNEVKAIKNTFGEAAKHLKVSSTKSMTGHLLGATGGIEAIFSALSIKD
    N315            LNAHGTSTPVGDLNEVKAIKNTFGEAAKHLKVSSTKSMTGHLLGATGGIEAIFSALSIKD
    NCTC8325        LNAHGTSTPVGDLNEVKAIKNTFGEAAKHLKVSSTKSMTGHLLGATGGIEAIFSALSIKD
    Newman          LNAHGTSTPVGDLNEVKAIKNTFGEAAKHLKVSSTKSMTGHLLGATGGIEAIFSALSIKD
    USA300_FPR3757  LNAHGTSTPVGDLNEVKAIKNTFGEAAKHLKVNSTKSMTGHLLGATGGIEAIFSALSIKD
                    ********************************.***************************

    COL             SKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKKFEA
    N315            SKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKKFEA
    NCTC8325        SKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKKFEA
    Newman          SKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKKFEA
    USA300_FPR3757  SKVAPTIHAVTPDPECDLDIVPNEAQDLDITYAMSNSLGFGGHNAVLVFKKFEA
                    ******************************************************