From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN003146000
  • symbol?: opp-4A
  • description?: peptide ABC transporter oligopeptide-binding protein

      descriptions from strain specific annotations:

    • peptide ABC transporter oligopeptide-binding protein
    • extracellular solute-binding protein
    • oligopeptide ABC transporter, oligopeptide-binding protein
    • Oligopeptide ABC transporter, periplasmic oligopeptide-binding protein oppA
    • extracellular solute-binding proteins, family 5 Middle family protein
    • oligopeptide ABC transporter oligopeptide-binding protein
    • oligopeptide ABC transporter substrate-binding protein
    • bacterial extracellular solute-binding s, 5 Middle family protein
    • transport system extracellular bindinglipoprotein
    • pseudogene
  • strand?: +
  • coordinates?: 3527687..3534337
  • synteny block?: BlockID0022350
  • occurrence?: in 59% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0946 (oppA)
    08BA02176:
    11819-97:
    MS7_0947
    71193:
    ECT-R 2:
    ECTR2_846
    ED133:
    ED98:
    SAAV_0952
    HO 5096 0412:
    JH1:
    SaurJH1_1009
    JH9:
    SaurJH9_0990
    JKD6008:
    SAA6008_00944
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR0954
    MSHR1132:
    MSSA476:
    Mu3:
    SAHV_0986
    Mu50:
    SAV0991
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_01024
    TCH60:
    TW20:
    SATW20_09890
    USA300_TCH1516:
    USA300HOU_0949 (oppA2)
    VC40:
    SAVC_04125

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGKLIKYISILLIVVLVLSACGKSSNKDEGVKDATKTETSKHKGGTLNVALTAPPSGVYS
    N315            MGKLIKYISILLIVVLVLSACGKSSNKDEGVKDATKTETSKHKGGTLNVALTAPPSGVYS
    NCTC8325        MGKLIKYISILLIVVLVLSACGKSSNKDEGVKDATKTETSKHKGGTLNVALTAPPSGVYS
    Newman          MGKLIKYISILLIVVLVLSACGKSSNKDEGVKDATKTETSKHKGGTLNVALTAPPSGVYS
    USA300_FPR3757  MGKLIKYISILLIVVLVLSACGKSSNKDEGVKDATKTETSKHKGGTLNVALTAPPSGVYS
                    ************************************************************

    COL             SLLNSTHADSVVEGYFNESLLATDKKIRPKAYIASWKDIEPAKKIEFKIKKGIKWHDGNE
    N315            SLLNSTHADSVVEGYFNESLLATDKKIRPKAYIASWKDIEPAKKIEFKIKKGIKWHDGNE
    NCTC8325        SLLNSTHADSVVEGYFNESLLATDKKIRPKAYIASWKDIEPAKKIEFKIKKGIKWHDGNE
    Newman          SLLNSTHADSVVEGYFNESLLATDKKIRPKAYIASWKDIEPAKKIEFKIKKGIKWHDGNE
    USA300_FPR3757  SLLNSTHADSVVEGYFNESLLATDKKIRPKAYIASWKDIEPAKKIEFKIKKGIKWHDGNE
                    ************************************************************

    COL             LKIDDWIYSIEVLANKDYEGAYYPSVENIQGAKDYHEGKTDHISGLKKIDDYTMQVTFDK
    N315            LKIDDWIYSIEVLANKDYEGAYYPSVENIQGAKDYHEGKTDHISGLKKIDDYTMQVTFDK
    NCTC8325        LKIDDWIYSIEVLANKDYEGAYYPSVENIQGAKDYHEGKTDHISGLKKIDDYTMQVTFDK
    Newman          LKIDDWIYSIEVLANKDYEGAYYPSVENIQGAKDYHEGKTDHISGLKKIDDYTMQVTFDK
    USA300_FPR3757  LKIDDWIYSIEVLANKDYEGAYYPSVENIQGAKDYHEGKTDHISGLKKIDDYTMQVTFDK
                    ************************************************************

    COL             KQENYLTGFITGPLLSKKYLSDVPIKDLAKSDKIRKYPIGIGPYKVKKIVPGEAVQLVKF
    N315            KQENYLTGFITGHLLSKKYLSDVPIKDLAKSDKIRKYPIGIGPYKVKKIVPGEAVQLVKF
    NCTC8325        KQENYLTGFITGPLLSKKYLSDVPIKDLAKSDKIRKYPIGIGPYKVKKIVPGEAVQLVKF
    Newman          KQENYLTGFITGPLLSKKYLSDVPIKDLAKSDKIRKYPIGIGPYKVKKIVPGEAVQLVKF
    USA300_FPR3757  KQENYLTGFITGPLLSKKYLSDVPIKDLAKSDKIRKYPIGIGPYKVKKIVPGEAVQLVKF
                    ************ ***********************************************

    COL             DDYWQGKPALDKINLKVIDQAQIIKAMEKGDIDVANDATGAMAKDAKSSNAGLKVLSAPS
    N315            DDYWQGKPALDKINLKVIDQAQIIKAMEKGDIDVANDATGAMAKDAKSSNAGLKVLSAPS
    NCTC8325        DDYWQGKPALDKINLKVIDQAQIIKAMEKGDIDVANDATGAMAKDAKSSNAGLKVLSAPS
    Newman          DDYWQGKPALDKINLKVIDQAQIIKAMEKGDIDVANDATGAMAKDAKSSNAGLKVLSAPS
    USA300_FPR3757  DDYWQGKPALDKINLKVIDQAQIIKAMEKGDIDVANDATGAMAKDAKSSNAGLKVLSAPS
                    ************************************************************

    COL             LDYGLIGFVSHDYDKKANKTGKVRPKYEDKELRKAMLYAIDREKWIKAFFNGYASEINSF
    N315            LDYGLIGFVSHDYDKKANKTGKVRPKYEDKELRKAMLYAIDREKWIKAFFNGYASEINSF
    NCTC8325        LDYGLIGFVSHDYDKKANKTGKVRPKYEDKELRKAMLYAIDREKWIKAFFNGYASEINSF
    Newman          LDYGLIGFVSHDYDKKANKTGKVRPKYEDKELRKAMLYAIDREKWIKAFFNGYASEINSF
    USA300_FPR3757  LDYGLIGFVSHDYDKKANKTGKVRPKYEDKELRKAMLYAIDREKWIKAFFNGYASEINSF
                    ************************************************************

    COL             VPSMHWIAANPKDLNDYKYDPEKAKKILDKLGYKDRDGDGFREDPKGNKFEINFKHYSGS
    N315            VPSMHWIAANPKDLNDYKYDPEKAKKILDKLGYKDRDGDGFREDPKGNKFEINFKHYSGS
    NCTC8325        VPSMHWIAANPKDLNDYKYDPEKAKKILDKLGYKDRDGDGFREDPKGNKFEINFKHNSGS
    Newman          VPSMHWIAANPKDLNDYKYDPEKAKKILDKLGYKDRDGDGFREDPKGNKFEINFKHYSGS
    USA300_FPR3757  VPSMHWIAANPKDLNDYKYDPEKAKKILDKLGYKDRDGDGFREDPKGNKFEINFKHYSGS
                    ******************************************************** ***

    COL             NPTFEPRTAAIKDFWEKVGLKTNVKLVEFGKYNEDLANASKDMEVYFRSWAGGTDPDPSD
    N315            NPTFEPRTAAIKDFWEKVGLKTNVKLVEFGKYNEDLANASKDMEVYFRSWAGGTDPDPSD
    NCTC8325        NPTFEPRTAAIKDFWEKVGLKTNVKLVEFGKYNEDLANASKDMEVYFRSWAGGTDPDPSD
    Newman          NPTFEPRTAAIKDFWEKVGLKTNVKLVEFGKYNEDLANASKDMEVYFRSWAGGTDPDPSD
    USA300_FPR3757  NPTFEPRTAAIKDFWEKVGLKTNVKLVEFGKYNEDLANASKDMEVYFRSWAGGTDPDPSD
                    ************************************************************

    COL             LYHTDRPQNEMRTVLPKSDQYLDDALDFEKVGIDEKKRKDIYVKWQKYMNDELPGLPMFQ
    N315            LYHTDRPQNEMRTVLPKSDQYLDDALDFEKVGIDEKKRKDIYVKWQKYMNDELPGLPMFQ
    NCTC8325        LYHTDRPQNEMRTVLPKSDQYLDDALDFEKVGIDEKKRKDIYVKWQKYMNDELPGLPMFQ
    Newman          LYHTDRPQNEMRTVLPKSDQYLDDALDFEKVGIDEKKRKDIYVKWQKYMNDELPGLPMFQ
    USA300_FPR3757  LYHTDRPQNEMRTVLPKSDQYLDDALDFEKVGIDEKKRKDIYVKWQKYMNDELPGLPMFQ
                    ************************************************************

    COL             GKSITIVNDKVRNLDIEIGTDQSLYNLTKEA
    N315            GKSITIVNDKVRNLDIEIGTDQSLYNLTKEA
    NCTC8325        GKSITIVNDKVRNLDIEIGTDQSLYNLTKEA
    Newman          GKSITIVNDKVRNLDIEIGTDQSLYNLTKEA
    USA300_FPR3757  GKSITIVNDKVRNLDIEIGTDQSLYNLTKEA
                    *******************************