From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003152000
  • symbol?: opp-4B
  • description?: oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein

      descriptions from strain specific annotations:

    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • oligopeptide ABC transporter permease
    • putative oligopeptide transport system permease
    • oligopeptide ABC transporter membrane protein
    • pseudogene
    • oligopeptide transport system permease protein OppB
    • binding--dependent transport system inner membrane component family protein
    • oligopeptide transport system permease OppB
    • binding-protein-dependent transport systems inner membrane component
    • binding-protein-dependent transport system inner membrane component family protein
  • strand?: +
  • coordinates?: 3536677..3546835
  • synteny block?: BlockID0022410
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0853 (oppB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0949 (oppB)
    08BA02176:
    11819-97:
    MS7_0950
    71193:
    ECT-R 2:
    ECTR2_849
    ED133:
    SAOV_0940
    ED98:
    SAAV_0955
    HO 5096 0412:
    SAEMRSA15_08230
    JH1:
    SaurJH1_1012
    JH9:
    SaurJH9_0993
    JKD6008:
    SAA6008_00947
    JKD6159:
    LGA251:
    SARLGA251_09100 (appB)
    M013:
    M013TW_0916
    MRSA252:
    SAR0959
    MSHR1132:
    SAMSHR1132_08420
    MSSA476:
    SAS0864
    Mu3:
    SAHV_0989 (oppB)
    Mu50:
    SAV0994 (oppB)
    MW2:
    MW0876 (oppB)
    RF122:
    ST398:
    T0131:
    SAT0131_01027
    TCH60:
    HMPREF0772_12247 (appB)
    TW20:
    SATW20_09920 (appB)
    USA300_TCH1516:
    USA300HOU_0952 (oppB3)
    VC40:
    SAVC_04140

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIKLILKRLGLMIPLLILISIVVFSLAIIQPGDPFSDLQNGKIKQEAINAQREKLGLNDS
    N315            MLKLILKRLGLMIPLLILISIVVFSLAIIQPGDPFSDLQNGKIKQEAINAQREKLGLNDS
    NCTC8325        MIKLILKRLGLMIPLLILISIVVFSLAIIQPGDPFSDLQNGKIKQEAINAQREKLGLNDS
    Newman          MIKLILKRLGLMIPLLILISIVVFSLAIIQPGDPFSDLQNGKIKQEAINAQREKLGLNDS
    USA300_FPR3757  MIKLILKRLGLMIPLLILISIVVFSLAIIQPGDPFSDLQNGKIKQEAINAQREKLGLNDS
                    *:**********************************************************

    COL             IPHQYIRWVNHVIHGDLGESIKYKRPVIDVIEERIPNTILLGAMSLIITYIISFALGITS
    N315            IPHQYIRWVNHVIHGDLGESIKYKRPVIDVIEERIPNTILLGAMSLIITYIISFALGITS
    NCTC8325        IPHQYIRWVNHVIHGDLGESIKYKRPVIDVIEERIPNTILLGAMSLIITYIISFALGITS
    Newman          IPHQYIRWVNHVIHGDLGESIKYKRPVIDVIEERIPNTILLGAMSLIITYIISFALGITS
    USA300_FPR3757  IPHQYIRWVNHVIHGDLGESIKYKRPVIDVIEERIPNTILLGAMSLIITYIISFALGITS
                    ************************************************************

    COL             GRYSYSLTDYTVQIFNYLMLAIPSFIAGVFAIFIFSFELQWFPFQGSVDINLKEGTFEYY
    N315            GRYSYSLTDYTVQIFNYLMLAIPSFIAGVFAIFIFSFELQWFPFQGSVDINLKEGTFEYY
    NCTC8325        GRYSYSLTDYTVQIFNYLMLAIPSFIAGVFAIFIFSFELQWFPFQGSVDINLKEGTFEYY
    Newman          GRYSYSLTDYTVQIFNYLMLAIPSFIAGVFAIFIFSFELQWFPFQGSVDINLKEGTFEYY
    USA300_FPR3757  GRYSYSLTDYTVQIFNYLMLAIPSFIAGVFAIFIFSFELQWFPFQGSVDINLKEGTFEYY
                    ************************************************************

    COL             MSKIYHTFLPAFTLGLLSTAGYIQYLRNDIIENSKKDYVLTARSKGLSMNKIYNKHILRN
    N315            MSKIYHTFLPALTLGLLSTAGYIQYLRNDIIENSKKDYVLTARSKGLSMNKIYNKHILRN
    NCTC8325        MSKIYHTFLPAFTLGLLSTAGYIQYLRNDIIENSKKDYVLTARSKGLSMNKIYNKHILRN
    Newman          MSKIYHTFLPAFTLGLLSTAGYIQYLRNDIIENSKKDYVLTARSKGLSMNKIYNKHILRN
    USA300_FPR3757  MSKIYHTFLPAFTLGLLSTAGYIQYLRNDIIENSKKDYVLTARSKGLSMNKIYNKHILRN
                    ***********:************************************************

    COL             SLIPIITFLGADIVSILGGAVITETIFSYNGIGKLFLESVIGQDYPLMMALTLFFSFLGL
    N315            SLIPIITFLGADIVSILGGAVITETIFSYNGIGKLFLESVIGQDYPLMMALTLFFSFLGL
    NCTC8325        SLIPIITFLGADIVSILGGAVITETIFSYNGIGKLFLESVIGQDYPLMMALTLFFSFLGL
    Newman          SLIPIITFLGADIVSILGGAVITETIFSYNGIGKLFLESVIGQDYPLMMALTLFFSFLGL
    USA300_FPR3757  SLIPIITFLGADIVSILGGAVITETIFSYNGIGKLFLESVIGQDYPLMMALTLFFSFLGL
                    ************************************************************

    COL             LGNLISDITYGFIDPRIRSN
    N315            LGNLISDITYGFIDPRIRSN
    NCTC8325        LGNLISDITYGFIDPRIRSN
    Newman          LGNLISDITYGFIDPRIRSN
    USA300_FPR3757  LGNLISDITYGFIDPRIRSN
                    ********************