From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003164000
  • symbol?: spxA
  • description?: transcriptional regulator Spx

      descriptions from strain specific annotations:

    • transcriptional regulator Spx
    • Spx family transcriptional regulator
    • Arsenate reductase family protein
    • regulatory protein Spx
    • proabable transcriptional regulator
  • strand?: +
  • coordinates?: 3557958..3558389
  • synteny block?: BlockID0022520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1002 (spxA)
    N315:
    SA0856 (spxA)
    NCTC8325:
    Newman:
    NWMN_0867 (spxA)
    USA300_FPR3757:
    04-02981:
    SA2981_0952
    08BA02176:
    C248_1020 (spx)
    11819-97:
    MS7_0953 (spxA)
    71193:
    ST398NM01_0993
    ECT-R 2:
    ECTR2_852
    ED133:
    SAOV_0943
    ED98:
    SAAV_0958 (spxA)
    HO 5096 0412:
    SAEMRSA15_08270
    JH1:
    SaurJH1_1015 (spxA)
    JH9:
    SaurJH9_0996 (spxA)
    JKD6008:
    SAA6008_00950 (spxA)
    JKD6159:
    SAA6159_00854 (spxA)
    LGA251:
    SARLGA251_09130 (spxA)
    M013:
    M013TW_0920
    MRSA252:
    SAR0965 (spxA)
    MSHR1132:
    SAMSHR1132_08450
    MSSA476:
    SAS0867 (spxA)
    Mu3:
    SAHV_0992 (spxA)
    Mu50:
    SAV0997 (spxA)
    MW2:
    MW0879 (spxA)
    RF122:
    SAB0864 (spxA)
    ST398:
    SAPIG0993
    T0131:
    SAT0131_01032 (rho)
    TCH60:
    HMPREF0772_12239 (spxA)
    TW20:
    SATW20_09950 (spxA)
    USA300_TCH1516:
    USA300HOU_0955 (spxA)
    VC40:
    SAVC_04155 (spxA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
    N315            MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
    NCTC8325        MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
    Newman          MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
    USA300_FPR3757  MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
                    ************************************************************

    COL             SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDNKRLQVGYNEDEIRRFLPRKVRT
    N315            SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDNKRLQVGYNEDEIRRFLPRKVRT
    NCTC8325        SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDNKRLQVGYNEDEIRRFLPRKVRT
    Newman          SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDNKRLQVGYNEDEIRRFLPRKVRT
    USA300_FPR3757  SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDNKRLQVGYNEDEIRRFLPRKVRT
                    ************************************************************

    COL             FQLQEAQRMVD
    N315            FQLQEAQRMVD
    NCTC8325        FQLQEAQRMVD
    Newman          FQLQEAQRMVD
    USA300_FPR3757  FQLQEAQRMVD
                    ***********