From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003170000
  • symbol?: trfB
  • description?: transcription factor

      descriptions from strain specific annotations:

    • transcription factor
    • competence CoiA family protein
    • competence protein, putative
    • Competence protein CoiA
    • competence protein CoiA-like family protein
    • putative competence protein
    • pseudogene
    • competence-related protein
    • competence protein/transcription factor
    • competence CoiA-like family protein
  • strand?: +
  • coordinates?: 3561901..3562924
  • synteny block?: BlockID0022570
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0954 (coiA)
    08BA02176:
    C248_1022
    11819-97:
    MS7_0955
    71193:
    ST398NM01_0995
    ECT-R 2:
    ECTR2_854
    ED133:
    SAOV_0945
    ED98:
    SAAV_0962
    HO 5096 0412:
    SAEMRSA15_08300
    JH1:
    SaurJH1_1017
    JH9:
    SaurJH9_0998
    JKD6008:
    SAA6008_00953 (coiA)
    JKD6159:
    SAA6159_00856 (coiA)
    LGA251:
    SARLGA251_09150
    M013:
    M013TW_0922
    MRSA252:
    SAR0967
    MSHR1132:
    SAMSHR1132_08470
    MSSA476:
    SAS0869
    Mu3:
    SAHV_0994
    Mu50:
    SAV0999
    MW2:
    MW0881
    RF122:
    SAB0866
    ST398:
    SAPIG0995
    T0131:
    SAT0131_01035 (murA2)
    TCH60:
    HMPREF0772_12237
    TW20:
    SATW20_09970
    USA300_TCH1516:
    USA300HOU_0957
    VC40:
    SAVC_04165

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLVALNEEKERVLATTALRKTQYFCPVCGKQVILKRGLKVISHFAHKHLAEQKCFNNETI
    N315            MLVALNEEKERVLATTALRKTQYFCPVCGKQVILKRGLKVISHFAHKHLAEQKCFNNETI
    NCTC8325        MLVALNEEKERVLATTALRKTQYFCPVCGKQVILKRGLKVISHFAHKHLAEQKCFNNETI
    Newman          MLVALNEEKERVLATTALRKTQYFCPVCGKQVILKRGLKVISHFAHKHLAEQKCFNNETI
    USA300_FPR3757  ------------------------------------------------------------
                                                                                

    COL             KHYKSKLILAQMIQQQGCKVEIEPFLKEIKQIPDILINNKYVIELQYSPIPYKQILQRTE
    N315            KHYKSKLILAQMIQQQGCKVEIEPFLKEIKQIPDILINNKYVIELQYSPIPYKQILQRTE
    NCTC8325        KHYKSKLILAQMIQQQGCKVEIEPFLKEIKQIPDILINNKYVIELQYSPIPYKQILQRTE
    Newman          KHYKSKLILAQMIQQQGCKVEIEPFLKEIKQIPDILINNKYVIELQYSPIPYKQILQRTE
    USA300_FPR3757  -----------------------------------MINNKYVIELQYSPIPYKQILQRTE
                                                       :************************

    COL             GLKKMGYKVSWLLNDVDYCHNKVKFNHFQSMFINPFTRKLHTFNLEKKQIMMFQQIQYLG
    N315            GLKKMGYKVSWLLNDVDYCHNKVKFNHFHSLFINPITRKLHTFNLEKKQIMMFQQIQYLG
    NCTC8325        GLKKMGYKVSWLLNDVDYCHNKVKFNHFQSMFINPFTRKLHTFNLEKKQIMMFQQIQYLG
    Newman          GLKKMGYKVSWLLNDVDYCHNKVKFNHFQSMFINPFTRKLHTFNLEKKQIMMFQQIQYLG
    USA300_FPR3757  GLKKMGYKVSWLLNDVDYCHNKVKFNHFQSMFINPFTRKLHTFNLEKKQIMMFQQIQYLG
                    ****************************:*:****:************************

    COL             GHKYVAEKRNAKISELFNEAPCDYHAVYKLSKFAINQYIKYCRWQNSVLEPTLSAMYQLQ
    N315            GHKYVAEKRNAKIIELFNEAPCDYHAVYKLSKFAINQYIKYCRWQNSVLEPTLSAMYQLQ
    NCTC8325        GHKYVAEKRNAKISELFNEAPCDYHAVYKLSKFAINQYIKYCRWQNSVLEPTLSAMYQLQ
    Newman          GHKYVAEKRNAKISELFNEAPCDYHAVYKLSKFAINQYIKYCRWQNSVLEPTLSAMYQLQ
    USA300_FPR3757  GHKYVAEKRNAKISELFNEAPCDYHAVYKLSKFAINQYIKYCRWQNSVLEPTLSAMYQLQ
                    ************* **********************************************

    COL             LTDQEVVHNYGYIFPEQIYIKNHPIEWQLQVDLWLKNGKSKLVNDNLNYFKLKKFIVALE
    N315            LTDQEVVYNYGYIFPEQIYIENHPIEWQLQVDLWLKNGKSKLVNDNLNYFKLKKFIVALE
    NCTC8325        LTDQEVVHNYGYIFPEQIYIKNHPIEWQLQVDLWLKNGKSKLVNDNLNYFKLKKFIVALE
    Newman          LTDQEVVHNYGYIFPEQIYIKNHPIEWQLQVDLWLKNGKSKLVNDNLNYFKLKKFIVALE
    USA300_FPR3757  LTDQEVVHNYGYIFPEQIYIKNHPIEWQLQVDLWLKNGKSKLVNDNLNYFKLKKFIVALE
                    *******:************:***************************************

    COL             SKTAIIEKLINNYLNICSDKGNDVQILF
    N315            SKTAIIEKLINNYLNICSDRGNDVQILF
    NCTC8325        SKTAIIEKLINNYLNICSDKGNDVQILF
    Newman          SKTAIIEKLINNYLNICSDKGNDVQILF
    USA300_FPR3757  SKTAIIEKLINNYLNICSDKGNDVQILF
                    *******************:********