From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003177000
  • symbol?: relQ
  • description?: GTP pyrophosphokinase

      descriptions from strain specific annotations:

    • GTP pyrophosphokinase
    • GTP diphosphokinase
    • GTP pyrophosphokinase yjbM
    • region found in RelA / SpoT proteins family protein
    • RelA/SpoT domain-containing protein
    • RelA/SpoT family protein
  • strand?: +
  • coordinates?: 3567899..3568534
  • synteny block?: BlockID0022640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1010 (relA1)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0960
    08BA02176:
    C248_1028
    11819-97:
    MS7_0961 (yjbM)
    71193:
    ST398NM01_1001
    ECT-R 2:
    ECTR2_860
    ED133:
    SAOV_0951
    ED98:
    SAAV_0968 (relA1)
    HO 5096 0412:
    SAEMRSA15_08360
    JH1:
    SaurJH1_1023
    JH9:
    SaurJH9_1004
    JKD6008:
    SAA6008_00959
    JKD6159:
    SAA6159_00862
    LGA251:
    SARLGA251_09210
    M013:
    M013TW_0928
    MRSA252:
    SAR0973
    MSHR1132:
    SAMSHR1132_08530
    MSSA476:
    SAS0875
    Mu3:
    SAHV_1000
    Mu50:
    SAV1006
    MW2:
    MW0887
    RF122:
    SAB0872
    ST398:
    SAPIG1001
    T0131:
    SAT0131_01041 (pyrG)
    TCH60:
    HMPREF0772_12231 (relA2)
    TW20:
    SATW20_10030
    USA300_TCH1516:
    USA300HOU_0963 (relA1)
    VC40:
    SAVC_04195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNQWDQFLTPYKQAVDELKVKLKGMRKQYEVGEQASPIEFVTGRVKPIASIIDKANKRQI
    N315            MNQWDQFLTPYKQAVDELKVKLKGMRKQYEVGEQASPIEFVTGRVKPIASIIDKANKRQI
    NCTC8325        MNQWDQFLTPYKQAVDELKVKLKGMRKQYEVGEQASPIEFVTGRVKPIASIIDKANKRQI
    Newman          MNQWDQFLTPYKQAVDELKVKLKGMRKQYEVGEQASPIEFVTGRVKPIASIIDKANKRQI
    USA300_FPR3757  MNQWDQFLTPYKQAVDELKVKLKGMRKQYEVGEQASPIEFVTGRVKPIASIIDKANKRQI
                    ************************************************************

    COL             PFDRLREEMYDIAGLRMMCQFVEDIDVVVNILRQRKDFKVIEERDYIRNTKESGYRSYHV
    N315            PFDRLREEMYDIAGLRMMCQFVEDIDVVVNILRQRKDFKVIEERDYIRNTKESGYRSYHV
    NCTC8325        PFDRLREEMYDIAGLRMMCQFVEDIDVVVNILRQRKDFKVIEERDYIRNTKESGYRSYHV
    Newman          PFDRLREEMYDIAGLRMMCQFVEDIDVVVNILRQRKDFKVIEERDYIRNTKESGYRSYHV
    USA300_FPR3757  PFDRLREEMYDIAGLRMMCQFVEDIDVVVNILRQRKDFKVIEERDYIRNTKESGYRSYHV
                    ************************************************************

    COL             IIEYPIETLQGQKFILAEIQIRTLAMNFWATIEHTLRYKYDGAYPDEIQHRLERAAEAAY
    N315            IIEYPIETLQGQKFILAEIQIRTLAMNFWATIEHTLRYKYDGAYPDEIQHRLERAAEAAY
    NCTC8325        IIEYPIETLQGQKFILAEIQIRTLAMNFWATIEHTLRYKYDGAYPDEIQHRLERAAEAAY
    Newman          IIEYPIETLQGQKFILAEIQIRTLAMNFWATIEHTLRYKYDGAYPDEIQHRLERAAEAAY
    USA300_FPR3757  IIEYPIETLQGQKFILAEIQIRTLAMNFWATIEHTLRYKYDGAYPDEIQHRLERAAEAAY
                    ************************************************************

    COL             LLDEEMSEIKDEIQEAQKYYTQKRSKKHEND
    N315            LLDEEMSEIKDEIQEAQKYYTQKRSKKHEND
    NCTC8325        LLDEEMSEIKDEIQEAQKYYTQKRSKKHEND
    Newman          LLDEEMSEIKDEIQEAQKYYTQKRSKKHEND
    USA300_FPR3757  LLDEEMSEIKDEIQEAQKYYTQKRSKKHEND
                    *******************************