From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003178000
  • symbol?: ppnK
  • description?: inorganic polyphosphate/ATP-NAD kinase

      descriptions from strain specific annotations:

    • inorganic polyphosphate/ATP-NAD kinase
    • NAD(+) kinase
    • ATP-NAD kinase family protein
  • strand?: +
  • coordinates?: 3568551..3569360
  • synteny block?: BlockID0022650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1011 (ppnK)
    N315:
    SA0865 (ppnK)
    NCTC8325:
    Newman:
    NWMN_0877 (ppnK)
    USA300_FPR3757:
    04-02981:
    SA2981_0961
    08BA02176:
    C248_1029
    11819-97:
    MS7_0962
    71193:
    ST398NM01_1002
    ECT-R 2:
    ECTR2_861
    ED133:
    SAOV_0952
    ED98:
    SAAV_0969 (ppnK)
    HO 5096 0412:
    SAEMRSA15_08370
    JH1:
    SaurJH1_1024 (ppnK)
    JH9:
    SaurJH9_1005 (ppnK)
    JKD6008:
    SAA6008_00960 (ppnK)
    JKD6159:
    SAA6159_00863 (ppnK)
    LGA251:
    SARLGA251_09220 (ppnK)
    M013:
    M013TW_0929
    MRSA252:
    SAR0974 (ppnK)
    MSHR1132:
    SAMSHR1132_08540
    MSSA476:
    SAS0876 (ppnK)
    Mu3:
    SAHV_1001 (ppnK)
    Mu50:
    SAV1007 (ppnK)
    MW2:
    MW0888 (ppnK)
    RF122:
    SAB0873 (ppnK)
    ST398:
    SAPIG1002
    T0131:
    SAT0131_01042 (rpoE)
    TCH60:
    HMPREF0772_12230 (ppnK)
    TW20:
    SATW20_10040 (ppnK)
    USA300_TCH1516:
    USA300HOU_0964 (ppnK)
    VC40:
    SAVC_04200 (ppnK)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRYTILTKGDSKSNALKHKMMNYMKDFRMIEDSENPEIVISVGGDGTLLQAFHQYSHMLS
    N315            MRYTILTKGDSKSNALKHKMMNYMKDFRMIEDSENPEIVISVGGDGTLLQAFHQYSHMLS
    NCTC8325        MRYTILTKGDSKSNALKHKMMNYMKDFRMIEDSENPEIVISVGGDGTLLQAFHQYSHMLS
    Newman          MRYTILTKGDSKSNALKHKMMNYMKDFRMIEDSENPEIVISVGGDGTLLQAFHQYSHMLS
    USA300_FPR3757  MRYTILTKGDSKSNALKHKMMNYMKDFRMIEDSENPEIVISVGGDGTLLQAFHQYSHMLS
                    ************************************************************

    COL             KVAFVGVHTGHLGFYADWLPHEVEKLIIEINNSEFQVIEYPLLEIIMRYNDNGYETRYLA
    N315            KVAFVGVHTGHLGFYADWLPHEVEKLIIEINNSEFQVIEYPLLEIIMRYNDNGYETRYLA
    NCTC8325        KVAFVGVHTGHLGFYADWLPHEVEKLIIEINNSEFQVIEYPLLEIIMRYNDNGYETRYLA
    Newman          KVAFVGVHTGHLGFYADWLPHEVEKLIIEINNSEFQVIEYPLLEIIMRYNDNGYETRYLA
    USA300_FPR3757  KVAFVGVHTGHLGFYADWLPHEVEKLIIEINNSEFQVIEYPLLEIIMRYNDNGYETRYLA
                    ************************************************************

    COL             LNEATMKTENGSTLVVDVNLRGKHFERFRGDGLCVSTPSGSTAYNKALGGALIHPSLEAM
    N315            LNEATMKTENGSTLVVDVNLRGKHFERFRGDGLCVSTPSGSTAYNKALGGALIHPSLEAM
    NCTC8325        LNEATMKTENGSTLVVDVNLRGKHFERFRGDGLCVSTPSGSTAYNKALGGALIHPSLEAM
    Newman          LNEATMKTENGSTLVVDVNLRGKHFERFRGDGLCVSTPSGSTAYNKALGGALIHPSLEAM
    USA300_FPR3757  LNEATMKTENGSTLVVDVNLRGKHFERFRGDGLCVSTPSGSTAYNKALGGALIHPSLEAM
                    ************************************************************

    COL             QITEIASINNRVFRTVGSPLVLPKHHTCLISPVNHDTIRMTIDHVSIKHKNVNSIQYRVA
    N315            QITEIASINNRVFRTVGSPLVLPKHHTCLISPVNHDTIRMTIDHVSIKHKNVNSIQYRVA
    NCTC8325        QITEIASINNRVFRTVGSPLVLPKHHTCLISPVNHDTIRMTIDHVSIKHKNVNSIQYRVA
    Newman          QITEIASINNRVFRTVGSPLVLPKHHTCLISPVNHDTIRMTIDHVSIKHKNVNSIQYRVA
    USA300_FPR3757  QITEIASINNRVFRTVGSPLVLPKHHTCLISPVNHDTIRMTIDHVSIKHKNVNSIQYRVA
                    ************************************************************

    COL             NEKVRFARFRPFPFWKRVHDSFISSDEER
    N315            NEKVRFARFRPFPFWKRVHDSFISSDEER
    NCTC8325        NEKVRFARFRPFPFWKRVHDSFISSDEER
    Newman          NEKVRFARFRPFPFWKRVHDSFISSDEER
    USA300_FPR3757  NEKVRFARFRPFPFWKRVHDSFISSDEER
                    *****************************