From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003186000
  • symbol?:
  • description?: AI-2E family transporter

      descriptions from strain specific annotations:

    • AI-2E family transporter
    • domain of unknown function, putative
    • membrane protein
    • membrane spanning protein
    • putative permease
  • strand?: -
  • coordinates?: 3576229..3577245
  • synteny block?: BlockID0022730
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0966
    08BA02176:
    C248_1036
    11819-97:
    MS7_0967
    71193:
    ST398NM01_1007
    ECT-R 2:
    ECTR2_866
    ED133:
    SAOV_0957c
    ED98:
    SAAV_0974
    HO 5096 0412:
    SAEMRSA15_08420
    JH1:
    SaurJH1_1029
    JH9:
    SaurJH9_1010
    JKD6008:
    SAA6008_00966
    JKD6159:
    SAA6159_00868
    LGA251:
    SARLGA251_09270
    M013:
    M013TW_0934
    MRSA252:
    SAR0979
    MSHR1132:
    SAMSHR1132_08590
    MSSA476:
    SAS0881
    Mu3:
    SAHV_1006
    Mu50:
    SAV1012
    MW2:
    MW0893
    RF122:
    SAB0878c
    ST398:
    SAPIG1007
    T0131:
    TCH60:
    HMPREF0772_12224
    TW20:
    SATW20_10090
    USA300_TCH1516:
    USA300HOU_0970
    VC40:
    SAVC_04225

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLNKVWFRTGIALIMLFILIKLFMEVHEVFTPIATIIGSVFLPFLISGFLFYICLPFQNL
    N315            MLNKVWFRTGIALIMLFILIKLFMEVHEVFTPIATIIGSVFLPFLISGFLFYICLPFQNL
    NCTC8325        MLNKVWFRTGIALIMLFILIKLFMEVHEVFTPIATIIGSVFLPFLISGFLFYICLPFQNL
    Newman          MLNKVWFRTGIALIMLFILIKLFMEVHEVFTPIATIIGSVFLPFLISGFLFYICLPFQNL
    USA300_FPR3757  MLNKVWFRTGIALIMLFILIKLFMEVHEVFTPIATIIGSVFLPFLISGFLFYICLPFQNL
                    ************************************************************

    COL             LEKVGFPRWASITTIMLALFAIIGLIVAFVAPIIISNINNLISQTPALQKEAEQIIKFAL
    N315            LEKVGFPRWASITTIMLALFAIIGLIVAFVAPIIISNINNLISQTPALQKEAEQIIKFAL
    NCTC8325        LEKVGFPRWASITTIMLALFAIIGLIVAFVAPIIISNINNLISQTPALQKEAEQIIKFAL
    Newman          LEKVGFPRWASITTIMLALFAIIGLIVAFVAPIIISNINNLISQTPALQKEAEQIIKFAL
    USA300_FPR3757  LEKVGFPRWASITTIMLALFAIIGLIVAFVAPIIISNINNLISQTPALQKEAEQIIKFAL
                    ************************************************************

    COL             AQMDKLPEDVTSRITNMVKSMGDGVTNILSNSLQYITSLISTIFLLIMVPFFLIYMLKDH
    N315            AQMDKLPEDVTSRITNMVKSMGDGVTNILSNSLQYITSLISTIFLLIMVPFFLIYMLKDH
    NCTC8325        AQMDKLPEDVTSRITNMVKSMGDGVTNILSNSLQYITSLISTIFLLIMVPFFLIYMLKDH
    Newman          AQMDKLPEDVTSRITNMVKSMGDGVTNILSNSLQYITSLISTIFLLIMVPFFLIYMLKDH
    USA300_FPR3757  AQMDKLPEDVTSRITNMVKSMGDGVTNILSNSLQYITSLISTIFLLIMVPFFLIYMLKDH
                    ************************************************************

    COL             EKFIPAVAKFFKGERKVFFVDLLTDLNFTLKSYIQGQVTVSVILGIFLYIGYSIIDLPYI
    N315            EKFIPAVAKFFKGERKVFFVDLLTDLNFTLKSYIQGQVTVSVILGIFLYIGYSIIDLPYI
    NCTC8325        EKFIPAVAKFFKGERKVFFVDLLTDLNFTLKSYIQGQVTVSVILGIFLYIGYSIIDLPYI
    Newman          EKFIPAVAKFFKGERKVFFVDLLTDLNFTLKSYIQGQVTVSVILGIFLYIGYSIIDLPYI
    USA300_FPR3757  EKFIPAVAKFFKGERKVFFVDLLTDLNFTLKSYIQGQVTVSVILGIFLYIGYSIIDLPYI
                    ************************************************************

    COL             PLLVLFAGVANLIPFLGSWLSFAPAAILGIIDSPTTFIWVCIITLIAHQLEGNIITPNVM
    N315            PLLVLFAGVANLIPFLGSWLSFAPAAILGIIDSPTTFIWVCIITLIAHQLEGNIITPNVM
    NCTC8325        PLLVLFAGVANLIPFLGSWLSFAPAAILGIIDSPTTFIWVCIITLIAHQLEGNIITPNVM
    Newman          PLLVLFAGVANLIPFLGSWLSFAPAAILGIIDSPTTFIWVCIITLIAHQLEGNIITPNVM
    USA300_FPR3757  PLLVLFAGVANLIPFLGSWLSFAPAAILGIIDSPTTFIWVCIITLIAHQLEGNIITPNVM
                    ************************************************************

    COL             GKSLSIHPLTIIVVILAAGDLGGFTLVLIAVPLYAVLKTVVSNIFKYRQRIIDKANSNVK
    N315            GKSLSIHPLTIIVVILAAGDLGGFTLVLIAVPLYAVLKTVVSNIFKYRQRIIDKANSNVK
    NCTC8325        GKSLSIHPLTIIVVILAAGDLGGFTLVLIAVPLYAVLKTVVSNIFKYRQRIIDKANSNVK
    Newman          GKSLSIHPLTIIVVILAAGDLGGFTLVLIAVPLYAVLKTVVSNIFKYRQRIIDKANSNVK
    USA300_FPR3757  GKSLSIHPLTIIVVILAAGDLGGFTLVLIAVPLYAVLKTVVSNIFKYRQRIIDKANSNVK
                    ************************************************************

    COL             D
    N315            D
    NCTC8325        D
    Newman          D
    USA300_FPR3757  D
                    *