From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003196000
  • symbol?: murE
  • description?: UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase

      descriptions from strain specific annotations:

    • UDP-N-acetylmuramoylalanyl-D-glutamate--L-lysine ligase
    • UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase
    • UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase
    • UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase
    • UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase)
  • strand?: +
  • coordinates?: 3588119..3589600
  • synteny block?: BlockID0022830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1023 (murE)
    N315:
    SA0876 (murE)
    NCTC8325:
    Newman:
    NWMN_0888 (murE)
    USA300_FPR3757:
    04-02981:
    SA2981_0972 (murE)
    08BA02176:
    C248_1042 (murE)
    11819-97:
    MS7_0974 (murE)
    71193:
    ST398NM01_1014
    ECT-R 2:
    ECTR2_873 (murE)
    ED133:
    SAOV_0963
    ED98:
    SAAV_0980
    HO 5096 0412:
    SAEMRSA15_08480 (murE)
    JH1:
    SaurJH1_1035
    JH9:
    SaurJH9_1016
    JKD6008:
    SAA6008_00973 (murE)
    JKD6159:
    SAA6159_00874 (murE)
    LGA251:
    SARLGA251_09330 (murE)
    M013:
    M013TW_0943
    MRSA252:
    SAR0988 (murE)
    MSHR1132:
    SAMSHR1132_08650
    MSSA476:
    SAS0887
    Mu3:
    SAHV_1012 (murE)
    Mu50:
    SAV1018 (murE)
    MW2:
    MW0899 (murE)
    RF122:
    SAB0884 (murE)
    ST398:
    SAPIG1014
    T0131:
    SAT0131_01053 (deoC)
    TCH60:
    HMPREF0772_12216 (murE2)
    TW20:
    SATW20_10150 (murE)
    USA300_TCH1516:
    USA300HOU_0976 (murE1)
    VC40:
    SAVC_04255

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDASTLFKKVKVKRVLGSLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQG
    N315            MDASTLFKKVKVKRVLGSLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQG
    NCTC8325        MDASTLFKKVKVKRVLGSLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQG
    Newman          MDASTLFKKVKVKRVLGSLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQG
    USA300_FPR3757  MDASTLFKKVKVKRVLGSLEQQIDDITTDSRTAREGSIFVASVGYTVDSHKFCQNVADQG
                    ************************************************************

    COL             CKLVVVNKEQSLPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATM
    N315            CKLVVVNKEQSLPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATM
    NCTC8325        CKLVVVNKEQSLPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATM
    Newman          CKLVVVNKEQSLPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATM
    USA300_FPR3757  CKLVVVNKEQSLPANVTQVVVPDTLRVASILAHTLYDYPSHQLVTFGVTGTNGKTSIATM
                    ************************************************************

    COL             IHLIQRKLQKNSAYLGTNGFQINETKTKGANTTPETVSLTKKIKEAVDAGAESMTLEVSS
    N315            IHLIQRKLQKNSAYLGTNGFQINETKTKGANTTPETVSLTKKIKEAVDAGAESMTLEVSS
    NCTC8325        IHLIQRKLQKNSAYLGTNGFQINETKTKGANTTPETVSLTKKIKEAVDAGAESMTLEVSS
    Newman          IHLIQRKLQKNSAYLGTNGFQINETKTKGANTTPETVSLTKKIKEAVDAGAESMTLEVSS
    USA300_FPR3757  IHLIQRKLQKNSAYLGTNGFQINETKTKGANTTPETVSLTKKIKEAVDAGAESMTLEVSS
                    ************************************************************

    COL             HGLVLGRLRGVEFDVAIFSNLTQDHLDFHGTMEAYGHAKSLLFSQLGEDLSKEKYVVLNN
    N315            HGLVLGRLRGVEFDVAIFSNLTQDHLDFHGTMEAYGHAKSLLFSQLGEDLSKEKYVVLNN
    NCTC8325        HGLVLGRLRGVEFDVAIFSNLTQDHLDFHGTMEAYGHAKSLLFSQLGEDLSKEKYVVLNN
    Newman          HGLVLGRLRGVEFDVAIFSNLTQDHLDFHGTMEAYGHAKSLLFSQLGEDLSKEKYVVLNN
    USA300_FPR3757  HGLVLGRLRGVEFDVAIFSNLTQDHLDFHGTMEAYGHAKSLLFSQLGEDLSKEKYVVLNN
                    ************************************************************

    COL             DDSFSEYLRTVTPYEVFSYGIDEEAQFMAKNIQESLQGVSFDFVTPFGTYPVKSPYVGKF
    N315            DDSFSEYLRTVTPYEVFSYGIDEEAQFMAKNIQESLQGVSFDFVTPFGTYPVKSPYVGKF
    NCTC8325        DDSFSEYLRTVTPYEVFSYGIDEEAQFMAKNIQESLQGVSFDFVTPFGTYPVKSPYVGKF
    Newman          DDSFSEYLRTVTPYEVFSYGIDEEAQFMAKNIQESLQGVSFDFVTPFGTYPVKSPYVGKF
    USA300_FPR3757  DDSFSEYLRTVTPYEVFSYGIDEEAQFMAKNIQESLQGVSFDFVTPFGTYPVKSPYVGKF
                    ************************************************************

    COL             NISNIMAAMIAVWSKGTSLETIIKAVENLEPVEGRLEVLDPSLPIDLIIDYAHTADGMNK
    N315            NISNIMAAMIAVWSKGTSLETIIKAVENLEPVEGRLEVLDPSLPIDLIIDYAHTADGMNK
    NCTC8325        NISNIMAAMIAVWSKGTSLETIIKAVENLEPVEGRLEVLDPSLPIDLIIDYAHTADGMNK
    Newman          NISNIMAAMIAVWSKGTSLETIIKAVENLEPVEGRLEVLDPSLPIDLIIDYAHTADGMNK
    USA300_FPR3757  NISNIMAAMIAVWSKGTSLETIIKAVENLEPVEGRLEVLDPSLPIDLIIDYAHTADGMNK
                    ************************************************************

    COL             LIDAVQPFVKQKLIFLVGMAGERDLTKTPEMGRVACRADYVIFTPDNPANDDPKMLTAEL
    N315            LIDAVQPFVKQKLIFLVGMAGERDLTKTPEMGRVACRADYVIFTPDNPANDDPKMLTAEL
    NCTC8325        LIDAVQPFVKQKLIFLVGMAGERDLTKTPEMGRVACRADYVIFTPDNPANDDPKMLTAEL
    Newman          LIDAVQPFVKQKLIFLVGMAGERDLTKTPEMGRVACRADYVIFTPDNPANDDPKMLTAEL
    USA300_FPR3757  LIDAVQPFVKQKLIFLVGMAGERDLTKTPEMGRVACRADYVIFTPDNPANDDPKMLTAEL
                    ************************************************************

    COL             AKGATHQNYIEFDDRAEGIKHAIDIAEPGDTVVLASKGREPYQIMPGHIKVPHRDDLIGL
    N315            AKGATHQNYIEFDDRAEGIKHAIDIAEPGDTVVLASKGREPYQIMPGHIKVPHRDDLIGL
    NCTC8325        AKGATHQNYIEFDDRAEGIKHAIDIAEPGDTVVLASKGREPYQIMPGHIKVPHRDDLIGL
    Newman          AKGATHQNYIEFDDRAEGIKHAIDIAEPGDTVVLASKGREPYQIMPGHIKVPHRDDLIGL
    USA300_FPR3757  AKGATHQNYIEFDDRAEGIKHAIDIAEPGDTVVLASKGREPYQIMPGHIKVPHRDDLIGL
                    ************************************************************

    COL             EAAYKKFGGGPVD-
    N315            EAAYKKFGGGPVDQ
    NCTC8325        EAAYKKFGGGPVD-
    Newman          EAAYKKFGGGPVD-
    USA300_FPR3757  EAAYKKFGGGPVD-
                    *************