From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003205000
  • symbol?: ktrD
  • description?: Na+transporting ATP synthase

      descriptions from strain specific annotations:

    • Na+transporting ATP synthase
    • H(+)-transporting two-sector ATPase
    • sodium transport family protein
    • Potassium uptake protein, integral membrane component, KtrD
    • cation transport family protein
    • Trk family K+ transporter membrane protein
    • putative sodium transport protein
    • Trk family potassium (K+) transporter, membrane protein
    • KtrB
  • strand?: +
  • coordinates?: 3595483..3596850
  • synteny block?: BlockID0022920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0977 (ktrD)
    08BA02176:
    C248_1046
    11819-97:
    MS7_0979
    71193:
    ST398NM01_1019
    ECT-R 2:
    ECTR2_878
    ED133:
    SAOV_0967
    ED98:
    SAAV_0986
    HO 5096 0412:
    SAEMRSA15_08530
    JH1:
    SaurJH1_1104
    JH9:
    SaurJH9_1082
    JKD6008:
    SAA6008_00978 (trkH)
    JKD6159:
    SAA6159_00879 (trkH)
    LGA251:
    SARLGA251_09380
    M013:
    M013TW_0950
    MRSA252:
    SAR0993
    MSHR1132:
    SAMSHR1132_08700
    MSSA476:
    SAS0956
    Mu3:
    SAHV_1017
    Mu50:
    SAV1024
    MW2:
    MW0904
    RF122:
    SAB0889
    ST398:
    SAPIG1019
    T0131:
    SAT0131_01058
    TCH60:
    HMPREF0772_12211 (ntpJ2)
    TW20:
    SATW20_10200
    USA300_TCH1516:
    USA300HOU_0981
    VC40:
    SAVC_04280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSIFSQFLKRSSPQQGIVLYYIVAIVIAFLLLNLPYVHKPGVEVNPIDTLFVAVSGISVT
    N315            MSIFSQFLKRSSPQQGIVLYYIVAIVIAFLLLNLPYVHKPGVEVNPIDTLFVAVSGISVT
    NCTC8325        MSIFSQFLKRSSPQQGIVLYYIVAIVIAFLLLNLPYVHKPGVEVNPIDTLFVAVSGISVT
    Newman          MSIFSQFLKRSSPQQGIVLYYIVAIVIAFLLLNLPYVHKPGVEVNPIDTLFVAVSGISVT
    USA300_FPR3757  MSIFSQFLKRSSPQQGIVLYYIVAIVIAFLLLNLPYVHKPGVEVNPIDTLFVAVSGISVT
                    ************************************************************

    COL             GLSPISIVDTYSTFGQLIILVILNIGGIGVMAIGTMLWVVLGKHIGIRERQLIMLDNNKN
    N315            GLSPISIVDTYSTFGQLIILVILNIGGIGVMAIGTMLWVVLGKHIGIRERQLIMLDNNKN
    NCTC8325        GLSPISIVDTYSTFGQLIILVILNIGGIGVMAIGTMLWVVLGKHIGIRERQLIMLDNNKN
    Newman          GLSPISIVDTYSTFGQLIILVILNIGGIGVMAIGTMLWVVLGKHIGIRERQLIMLDNNKN
    USA300_FPR3757  GLSPISIVDTYSTFGQLIILVILNIGGIGVMAIGTMLWVVLGKHIGIRERQLIMLDNNKN
                    ************************************************************

    COL             TMSGTVKLIIDIVKSIFVIELVGAMLLAFYFYRDNPDLKYAIMQGVFVSISATTNGGLDI
    N315            TMSGTVKLIIDIVKSIFVIELVGAMLLAFYFYRDNPDLKYAIMQGVFVSISATTNGGLDI
    NCTC8325        TMSGTVKLIIDIVKSIFVIELVGAMLLAFYFYRDNPDLKYAIMQGVFVSISATTNGGLDI
    Newman          TMSGTVKLIIDIVKSIFVIELVGAMLLAFYFYRDNPDLKYAIMQGVFVSISATTNGGLDI
    USA300_FPR3757  TMSGTVKLIIDIVKSIFVIELVGAMLLAFYFYRDNPDLKYAIMQGVFVSISATTNGGLDI
                    ************************************************************

    COL             TGKSLIPYAHDYFVQAIVIFLIILGSIGFPVLLEVKAYIQNRVTNFRFSLFTKITTSTYL
    N315            TGKSLIPYAHDYFVQAIVIFLIILGSIGFPVLLEVKAYIQNRVTNFRFSLFTKITTSTYL
    NCTC8325        TGKSLIPYAHDYFVQAIVIFLIILGSIGFPVLLEVKAYIQNRVTNFRFSLFTKITTSTYL
    Newman          TGKSLIPYAHDYFVQAIVIFLIILGSIGFPVLLEVKAYIQNRVTNFRFSLFTKITTSTYL
    USA300_FPR3757  TGKSLIPYAHDYFVQAIVIFLIILGSIGFPVLLEVKAYIQNRVTNFRFSLFTKITTSTYL
                    ************************************************************

    COL             FLFIVGVLAILLFEHNHAFKGLSWHQSLFYSLFQSATTRSAGLQTIDVTTLSDPTNIIMG
    N315            FLFIVGVLAILLFEHNHAFKGLSWHQSLFYSLFQSATTRSAGLQTIDVTTLSDPTNIIMG
    NCTC8325        FLFIVGVLAILLFEHNHAFKGLSWHQSLFYSLFQSATTRSAGLQTIDVTTLSDPTNIIMG
    Newman          FLFIVGVLAILLFEHNHAFKGLSWHQSLFYSLFQSATTRSAGLQTIDVTTLSDPTNIIMG
    USA300_FPR3757  FLFIVGVLAILLFEHNHAFKGLSWHQSLFYSLFQSATTRSAGLQTIDVTTLSDPTNIIMG
                    ************************************************************

    COL             ILMFIGSSPSSVGGGIRTTTFAILILFLINFSNNADKTSIKVYNREVHIMDIQRSFAVFT
    N315            ILMFIGSSPSSVGGGIRTTTFAILILFLINFSNNADKTSIKVYNREVHIMDIQRSFAVFT
    NCTC8325        ILMFIGSSPSSVGGGIRTTTFAILILFLINFSNNADKTSIKVYNREVHIMDIQRSFAVFT
    Newman          ILMFIGSSPSSVGGGIRTTTFAILILFLINFSNNADKTSIKVYNREVHIMDIQRSFAVFT
    USA300_FPR3757  ILMFIGSSPSSVGGGIRTTTFAILILFLINFSNNADKTSIKVYNREVHIMDIQRSFAVFT
                    ************************************************************

    COL             MATILTFLGMLIISATENGKLTFLQVFFEVMSAFGTCGLSLGVTSDISDISKVVLMILMF
    N315            MATILTFLGMLIISATENGKLTFLQVFFEVMSAFGTCGLSLGVTSDISDISKVVLMVLMF
    NCTC8325        MATILTFLGMLIISATENGKLTFLQVFFEVMSAFGTCGLSLGVTSDISDISKVVLMILMF
    Newman          MATILTFLGMLIISATENGKLTFLQVFFEVMSAFGTCGLSLGVTSDISDISKVVLMILMF
    USA300_FPR3757  MATILTFLGMLIISATENGKLTFLQVFFEVMSAFGTCGLSLGVTSDISDISKVVLMILMF
                    ********************************************************:***

    COL             IGRVGLISFIIMIAGRREPDKFHYPKERIQIG
    N315            IGRVGLISFIIMIAGRREPDKFHYPKERIQIG
    NCTC8325        IGRVGLISFIIMIAGRREPDKFHYPKERIQIG
    Newman          IGRVGLISFIIMIAGRREPDKFHYPKERIQIG
    USA300_FPR3757  IGRVGLISFIIMIAGRREPDKFHYPKERIQIG
                    ********************************