From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003211000
  • symbol?: comK1
  • description?: competence transcription factor

      descriptions from strain specific annotations:

    • competence transcription factor
    • ComK family protein
    • competence transcription factor ComK-like protein
    • competence protein
    • putative regulatory protein
    • competence transcription regulator ComK
  • strand?: -
  • coordinates?: 3599011..3599541
  • synteny block?: BlockID0022970
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_0895 (comK)
    USA300_FPR3757:
    04-02981:
    SA2981_0979
    08BA02176:
    C248_1050
    11819-97:
    MS7_0983
    71193:
    ST398NM01_1023
    ECT-R 2:
    ECTR2_882
    ED133:
    SAOV_0971c
    ED98:
    SAAV_0990
    HO 5096 0412:
    SAEMRSA15_08550
    JH1:
    SaurJH1_1106
    JH9:
    SaurJH9_1084
    JKD6008:
    SAA6008_00980 (comK)
    JKD6159:
    SAA6159_00881 (comK)
    LGA251:
    SARLGA251_09400
    M013:
    M013TW_0954
    MRSA252:
    SAR0995
    MSHR1132:
    SAMSHR1132_08720
    MSSA476:
    SAS0958
    Mu3:
    SAHV_1019
    Mu50:
    SAV1026
    MW2:
    MW0906
    RF122:
    SAB0891c
    ST398:
    SAPIG1023 (comK)
    T0131:
    SAT0131_01060
    TCH60:
    HMPREF0772_12209 (comK)
    TW20:
    SATW20_10220
    USA300_TCH1516:
    USA300HOU_0983
    VC40:
    SAVC_04290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------------MVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
    N315            MYSQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
    NCTC8325        -------------MVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
    Newman          MYSQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
    USA300_FPR3757  -------------MVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTY
                                 ***********************************************

    COL             LGKKAETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCK
    N315            LGKKAETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCK
    NCTC8325        LGKKAETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCK
    Newman          LGKKAETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCK
    USA300_FPR3757  LGKKAETNRITGISSKPPILLTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCK
                    ************************************************************

    COL             VTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMISKNPDQPIDYNKATLNVFEAL
    N315            VTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMISKNPDQPIDYNKATLNVFEAL
    NCTC8325        VTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMISKNPDQPIDYNKATLNVFEAL
    Newman          VTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMISKNPDQPIDYNKATLNVFEAL
    USA300_FPR3757  VTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMISKNPDQPIDYNKATLNVFEAL
                    ************************************************************

    COL             TRYSLFEDK
    N315            TRYSLFEDK
    NCTC8325        TRYSLFEDK
    Newman          TRYSLFEDK
    USA300_FPR3757  TRYSLFEDK
                    *********