From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003213000
  • symbol?: lplA1
  • description?: lipoate-protein ligase-like protein

      descriptions from strain specific annotations:

    • lipoate-protein ligase-like protein
    • lipoyltransferase and lipoate-protein ligase
    • lipoate-protein ligase A family protein
    • Lipoate-protein ligase A
    • lipoyltransferase and lipoate-protein ligase family protein
    • lipoate-protein ligase LplJ
    • putative lipoate-protein ligase A
  • strand?: -
  • coordinates?: 3600090..3601076
  • synteny block?: BlockID0022990
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0981
    08BA02176:
    C248_1052
    11819-97:
    MS7_0985 (lplJ)
    71193:
    ST398NM01_1025
    ECT-R 2:
    ECTR2_884
    ED133:
    SAOV_0973c
    ED98:
    SAAV_0992
    HO 5096 0412:
    SAEMRSA15_08570
    JH1:
    SaurJH1_1108
    JH9:
    SaurJH9_1086
    JKD6008:
    SAA6008_00982
    JKD6159:
    SAA6159_00883
    LGA251:
    SARLGA251_09420
    M013:
    M013TW_0956
    MRSA252:
    SAR0997
    MSHR1132:
    SAMSHR1132_08740
    MSSA476:
    SAS0960
    Mu3:
    SAHV_1021
    Mu50:
    SAV1028
    MW2:
    MW0908
    RF122:
    SAB0893c
    ST398:
    SAPIG1025
    T0131:
    SAT0131_01062
    TCH60:
    HMPREF0772_12207 (lplA2)
    TW20:
    SATW20_10240
    USA300_TCH1516:
    VC40:
    SAVC_04300

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFISNNNITDPTLNLAMEEYVLKNLPAEESYFLFYINRPSIIVGKNQNTIEEVNQTYID
    N315            MKFISNNNITDPTLNLAMEEYVLKNLPAEESYFLFYINRPSIIVGKNQNTIEEVNQTYID
    NCTC8325        MKFISNNNITDPTLNLAMEEYVLKNLPAEESYFLFYINRPSIIVGKNQNTIEEVNQTYID
    Newman          MKFISNNNITDPTLNLAMEEYVLKNLPAEESYFLFYINRPSIIVGKNQNTIEEVNQTYID
    USA300_FPR3757  MKFISNNNITDPTLNLAMEEYVLKNLPAEESYFLFYINRPSIIVGKNQNTIEEVNQTYID
                    ************************************************************

    COL             AHNIDVVRRISGGGAVYHDTGNLNFSFITDDDGNSFHNFQKFTEPIVQALQSLGVNAELT
    N315            AHNIDVVRRISGGGAVYHDTGNLNFSFITDDDGNSFHNFQKFTEPIVQALQSLGVNAELT
    NCTC8325        AHNIDVVRRISGGGAVYHDTGNLNFSFITDDDGNSFHNFQKFTEPIVQALQSLGVNAELT
    Newman          AHNIDVVRRISGGGAVYHDTGNLNFSFITDDDGNSFHNFQKFTEPIVQALQSLGVNAELT
    USA300_FPR3757  AHNIDVVRRISGGGAVYHDTGNLNFSFITDDDGNSFHNFQKFTEPIVQALQSLGVNAELT
                    ************************************************************

    COL             GRNDIQVGQAKISGNAMVKVKNRMFSHGTLMLNSDLDEVQNALKVNPAKIKSKGIKSVRK
    N315            GRNDIQVGQAKISGNAMVKVKNRMFSHGTLMLNSDLDEVQNALKVNPAKIKSKGIKSVRK
    NCTC8325        GRNDIQVGQAKISGNAMVKVKNRMFSHGTLMLNSDLDEVQNALKVNPAKIKSKGIKSVRK
    Newman          GRNDIQVGQAKISGNAMVKVKNRMFSHGTLMLNSDLDEVQNALKVNPAKIKSKGIKSVRK
    USA300_FPR3757  GRNDIQVGQAKISGNAMVKVKNRMFSHGTLMLNSDLDEVQNALKVNPAKIKSKGIKSVRK
                    ************************************************************

    COL             RVANIQEFLNDPLEIEEFKKIILKTIFGETEVEEYKLTDEDWENIEKLSNDKYRTWEWNY
    N315            RVANIQEFLNDPLEIEEFKKIILKTIFGETEVEEYKLTDEDWENIEKLSNDKYRTWAWNY
    NCTC8325        RVANIQEFLNDPLEIEEFKKIILKTIFGETEVEEYKLTDEDWENIEKLSNDKYRTWEWNY
    Newman          RVANIQEFLNDPLEIEEFKKIILKTIFGETEVEEYKLTDEDWENIEKLSNDKYRTWEWNY
    USA300_FPR3757  RVANIQEFLNDPLEIEEFKKIILKTIFGETEVEEYKLTDEDWENIEKLSNDKYRTWEWNY
                    ******************************************************** ***

    COL             GRNPKYNFEREEKFEKGFVQIKFDVKRGKIEHAKIFGDFFGVGDVTDLENALVGCLHDFE
    N315            GRNPKYNFEREEKFEKGFVQIKFDVKRGKIEHAKIFGDFFGVGDVTDLENALVGCLHDFE
    NCTC8325        GRNPKYNFEREEKFEKGFVQIKFDVKRGKIEHAKIFGDFFGVGDVTDLENALVGCLHDFE
    Newman          GRNPKYNFEREEKFEKGFVQIKFDVKRGKIEHAKIFGDFFGVGDVTDLENALVGCLHDFE
    USA300_FPR3757  GRNPKYNFEREEKFEKGFVQIKFDVKRGKIEHAKIFGDFFGVGDVTDLENALVGCLHDFE
                    ************************************************************

    COL             HIEEALSEYDLYHYFGDIDRHELIRLMS
    N315            HIEEALSEYDLYHYFGDIDRHELIRLMS
    NCTC8325        HIEEALSEYDLYHYFGDIDRHELIRLMS
    Newman          HIEEALSEYDLYHYFGDIDRHELIRLMS
    USA300_FPR3757  HIEEALSEYDLYHYFGDIDRHELIRLMS
                    ****************************