From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003214000
  • symbol?:
  • description?: hypothetical protein
  • strand?: +
  • coordinates?: 3601275..3601451
  • synteny block?: BlockID0023000
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0982
    08BA02176:
    C248_1053
    11819-97:
    MS7_0986
    71193:
    ST398NM01_1026
    ECT-R 2:
    ECTR2_885
    ED133:
    SAOV_0974
    ED98:
    SAAV_0993
    HO 5096 0412:
    SAEMRSA15_08580
    JH1:
    SaurJH1_1109
    JH9:
    SaurJH9_1087
    JKD6008:
    SAA6008_00983
    JKD6159:
    SAA6159_00884
    LGA251:
    SARLGA251_09430
    M013:
    M013TW_0957
    MRSA252:
    SAR0998
    MSHR1132:
    SAMSHR1132_08750
    MSSA476:
    SAS0961
    Mu3:
    SAHV_1022
    Mu50:
    SAV1029
    MW2:
    MW0909
    RF122:
    ST398:
    SAPIG1026
    T0131:
    SAT0131_01063 (czrA)
    TCH60:
    HMPREF0772_12206
    TW20:
    SATW20_10250
    USA300_TCH1516:
    VC40:
    SAVC_04305

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE
    N315            MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE
    NCTC8325        MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE
    Newman          MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE
    USA300_FPR3757  MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE
                    **********************************************************