From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0898 [new locus tag: NWMN_RS05030 ]
  • pan locus tag?: SAUPAN003214000
  • symbol: NWMN_0898
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0898 [new locus tag: NWMN_RS05030 ]
  • symbol: NWMN_0898
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 997977..998153
  • length: 177
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    ATGACTGTTGCAGAAGTGGGTAACATTGTTGAGTTTATGGATGGATTAAGAGGTCGTGTT
    GAAAAAATCAACGATAACTCTGTTATTGTTGACTTAACAATTATGGAAAATTTTAATGAC
    CTTGATTTACCGGAAAAAACTGTTATCAATCATAAACGATATAAGATTGTTGAATAA
    60
    120
    177

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0898 [new locus tag: NWMN_RS05030 ]
  • symbol: NWMN_0898
  • description: hypothetical protein
  • length: 58
  • theoretical pI: 4.46294
  • theoretical MW: 6676.64
  • GRAVY: -0.17069

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingpreprotein translocase, YajC subunit (TIGR00739; HMM-score: 13.6)
  • TheSEED:  
    FIG01108367: hypothetical protein 
  • PFAM:
    no clan definedDUF2187; Uncharacterized protein conserved in bacteria (DUF2187) (PF09953; HMM-score: 97.6)
    NTP_transf (CL0260) DUF2204; Nucleotidyl transferase of unknown function (DUF2204) (PF09970; HMM-score: 14.9)
    no clan definedYajC; Preprotein translocase subunit (PF02699; HMM-score: 13)
    Miga; Mitoguardin (PF10265; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_2032(rpoE)DNA-directed RNA polymerase subunit delta  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_1488(rpsT)30S ribosomal protein S20  [1] (data from MRSA252)
    NWMN_1607(tpx)thiol peroxidase  [1] (data from MRSA252)
    NWMN_0775hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 52
    • Cmax: 0.106
    • Cmax_pos: 23
    • Smax: 0.108
    • Smax_pos: 50
    • Smean: 0.077
    • D: 0.09
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]