From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003223000
  • symbol?:
  • description?: bacteriocin-associated integral membrane protein

      descriptions from strain specific annotations:

    • bacteriocin-associated integral membrane protein
    • membrane spanning protein
    • bacteriocin-associated integral membrane family protein
    • pseudogene
    • Membrane protein
    • bacteriocin-associated integral membrane (putative immunity) protein
  • strand?: +
  • coordinates?: 3605489..3607453
  • synteny block?: BlockID0023090
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0986
    08BA02176:
    C248_1056
    11819-97:
    MS7_0988
    71193:
    ST398NM01_1029
    ECT-R 2:
    ECTR2_887
    ED133:
    SAOV_0977
    ED98:
    SAAV_0995
    HO 5096 0412:
    SAEMRSA15_08620
    JH1:
    SaurJH1_1113
    JH9:
    SaurJH9_1091
    JKD6008:
    SAA6008_00985
    JKD6159:
    SAA6159_00887
    LGA251:
    SARLGA251_09460
    M013:
    M013TW_0961
    MRSA252:
    SAR1002
    MSHR1132:
    SAMSHR1132_08790
    MSSA476:
    SAS0965
    Mu3:
    SAHV_1026
    Mu50:
    SAV1033
    MW2:
    MW0914
    RF122:
    SAB0896
    ST398:
    SAPIG1029
    T0131:
    SAT0131_01065
    TCH60:
    HMPREF0772_12204
    TW20:
    SATW20_10280
    USA300_TCH1516:
    VC40:
    SAVC_04320

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKWFKLILDVTIFILIAILLFVYTYKENEEILPDTKYPIAVTDWNKKYSKNEIYKRIDQF
    N315            MKWFKLILDVTTFILIAILLFVYTYKENEEILPDTKYPIAVTDWNKKYSKNEIYKRINQF
    NCTC8325        MKWFKLILDVTIFILIAILLFVYTYKENEEILPDTKYPIAVTDWNKKYSKNEIYKRIDQF
    Newman          MKWFKLILDVTIFILIAILLFVYTYKENEEILPDTKYPIAVTDWNKKYSKNEIYKRIDQF
    USA300_FPR3757  MKWFKLILDVTIFILIAILLFVYTYKENEEILPDTKYPIAVTDWNKKYSKNEIYKRIDQF
                    *********** *********************************************:**

    COL             AKNENVAIYKSTSNYTNKNVDKDIYVFNKSKAATITPFNAKYNIHYLSDDEVLKKDIKGS
    N315            AKNENVAIYKSTSNYTNKNVDKDIYVFNKSKATTITPFNAKYNIHYLSDDELLKKDIKGS
    NCTC8325        AKNENVAIYKSTSNYTNKNVDKDIYVFNKSKAATITPFNAKYNIHYLSDDEVLKKDIKGS
    Newman          AKNENVAIYKSTSNYTNKNVDKDIYVFNKSKAATITPFNAKYNIHYLSDDEVLKKDIKGS
    USA300_FPR3757  AKNENVAIYKSTSNYTNKNVDKDIYVFNKSKAATITPFNAKYNIHYLSDDEVLKKDIKGS
                    ********************************:******************:********

    COL             YFVKDKNFDVSKFINFLKEYGVTAESYKIDHMMIAVGVIKQMNIVVPLSSLLIVYFIYYI
    N315            YFVKDKNFDVSKFINFLKEYGVTAESYKIDHMMIAVGVIKQMNIEVPLSALLIVYFIYYI
    NCTC8325        YFVKDKNFDVSKFINFLKEYGVTAESYKIDHMMIAVGVIKQMNIVVPLSSLLIVYFIYYI
    Newman          YFVKDKNFDVSKFINFLKEYGVTAESYKIDHMMIAVGVIKQMNIVVPLSSLLIVYFIYYI
    USA300_FPR3757  YFVKDKNFDVSKFINFLKEYGVTAESYKIDHMMIAVGVIKQMNIVVPLSSLLIVYFIYYI
                    ******************************************** ****:**********

    COL             FEKNINFKAYAIKYLNGFTLRKIIFENFSKKCTYWVTLIITQILLTTSVLWILNYTGNLD
    N315            FEKNINFKAYAIKYLNGFTLRKIIFENFSKKCTYWVTLIISQILLTTSVLWILNYTGNLD
    NCTC8325        FEKNINFKAYAIKYLNGFTLRKIIFENFSKKCTYWVTLIITQILLTTSVLWILNYTGNLD
    Newman          FEKNINFKAYAIKYLNGFTLRKIIFENFSKKCTYWVTLIITQILLTTSVLWILNYTGNLD
    USA300_FPR3757  FEKNINFKAYAIKYLNGFTLRKIIFENFSKKCTYWVTLIITQILLTTSVLWILNYTGNLD
                    ****************************************:*******************

    COL             LFILRIVLLSCLFILTISVINLWTFLMLLNLNIANMIKGKQHFKTIRFINTVCKSILLVL
    N315            LFILRLVLLSCLFILTISVINLWTFLMLLNLNIANMIKGKQHFKTIRFINTVCKSILLVL
    NCTC8325        LFILRIVLLSCLFILTISVINLWTFLMLLNLNIANMIKGKQHFKTIRFINTVCKSILLVL
    Newman          LFILRIVLLSCLFILTISVINLWTFLMLLNLNIANMIKGKQHFKTIRFINTVCKSILLVL
    USA300_FPR3757  LFILRIVLLSCLFILTISVINLWTFLMLLNLNIANMIKGKQHFKTIRFINTVCKSILLVL
                    *****:******************************************************

    COL             IANVMIENTSVIKDLNKIKETEKYWNVLDDYYTIEFAPYHETKQSLIDNMVRSEQLVKAS
    N315            IASVMIENTSVIKDLNKIKETEKYWNVLDDYYTIEFAPYHETKQSLIDNMLRSEQLVKAS
    NCTC8325        IANVMIENTSVIKDLNKIKETEKYWNVLDDYYTIEFAPYHETKQSLIDNMVRSEQLVKAS
    Newman          IANVMIENTSVIKDLNKIKETEKYWNVLDDYYTIEFAPYHETKQSLIDNMVRSEQLVKAS
    USA300_FPR3757  IANVMIENTSVIKDLNKIKETEKYWNVLDDYYTIEFAPYHETKQSLIDNMVRSEQLVKAS
                    **.***********************************************:*********

    COL             EAENNAILFKPKGDSVDNDNFSPDEGNVILVNNQFWSIYYKQFQPDIPIKNQKNNVEVII
    N315            EAENNAILFKPKGDSVDNDNFSPDEGNVILVNNQFWSIYYKQFQPDIPIKNQKNNVEVII
    NCTC8325        EAENNAILFKPKGDSVDNDNFSPDEGNVILVNNQFWSIYYKQFQPDIPIKNQKNNVEVII
    Newman          EAENNAILFKPKGDSVDNDNFSPDEGNVILVNNQFWSIYYKQFQPDIPIKNQKNNVEVII
    USA300_FPR3757  EAENNAILFKPKGDSVDNDNFSPDEGNVILVNNQFWSIYYKQFQPDIPIKNQKNNVEVII
                    ************************************************************

    COL             PQKFHAMRNEINQAYHSWFEFVQNKNNKENKLSIQFINKNDCRIFSFDARDSRHLSFIEA
    N315            PQKFHAMRNEINQAYHSWFEFVQNKNNKENKLSIQFINKNDYRIFSFDARDSRHLSFIEA
    NCTC8325        PQKFHAMRNEINQAYHSWFEFVQNKNNKENKLSIQFINKNDCRIFSFDARDSRHLSFIEA
    Newman          PQKFHAMRNEINQAYHSWFEFVQNKNNKENKLSIQFINKNDCRIFSFDARDSRHLSFIEA
    USA300_FPR3757  PQKFHAMRNEINQAYHSWFEFVQNKNNKENKLSIQFINKNDCRIFSFDARDSRHLSFIEA
                    ***************************************** ******************

    COL             PIIVNVQASDLSNDFYYAMISQGGYLFKNYDALVKNIEKYHLDGEISGITNYKDSVMEMY
    N315            PIIVNVQASDLSNDFYYAMISQGGYLFKNYDALVKNIENYHLDGEISGITNYKDSVMEMY
    NCTC8325        PIIVNVQASDLSNDFYYAMISQGGYLFKNYDALVKNIEKYHLDGEISGITNYKDSVMEMY
    Newman          PIIVNVQASDLSNDFYYAMISQGGYLFKNYDALVKNIEKYHLDGEISGITNYKDSVMEMY
    USA300_FPR3757  PIIVNVQASDLSNDFYYAMISQGGYLFKNYDALVKNIEKYHLDGEISGITNYKDSVMEMY
                    **************************************:*********************

    COL             HENNLKLTVLNFSQIIIAIILIIIILFDVKYYFEQHRKLLVIKKLYGYSTLRANYQYLLI
    N315            HENNLKLTVLNFSQIIIAIILIIIILFDVKYYFEQHRKLLVIKKLYGYSTLRANYQYLLI
    NCTC8325        HENNLKLTVLNFSQIIIAIILIIIILFDVKYYFEQHRKLLVIKKLYGYSTLRANYQYLLI
    Newman          HENNLKLTVLNFSQIIIAIILIIIILFDVKYYFEQHRKLLVIKKLYGYSTLRANYQYLLI
    USA300_FPR3757  HENNLKLTVLNFSQIIIAIILIIIILFDVKYYFEQHRKLLVIKKLYGYSTLRANYQYLLI
                    ************************************************************

    COL             NNIVVIFIGILTNVILHSHYIMMLFATILVVQILLQICSLYYHGRRFNEVIKEF
    N315            NNIVVVFIGILTNVILHSQYIMMIFATILVVQILLQICSLYYHGRRFNEVIKEF
    NCTC8325        NNIVVIFIGILTNVILHSHYIMMLFATILVVQILLQICSLYYHGRRFNEVIKEF
    Newman          NNIVVIFIGILTNVILHSHYIMMLFATILVVQILLQICSLYYHGRRFNEVIKEF
    USA300_FPR3757  NNIVVIFIGILTNVILHSHYIMMLFATILVVQILLQICSLYYHGRRFNEVIKEF
                    *****:************:****:******************************