From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003225000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC transporter family protein
    • pseudogene
    • ABC superfamily ATP binding cassette transporter, ABC protein
    • putative bacteriocin export ABC transporter
    • ABC transporter, ATP-binding protein
  • strand?: +
  • coordinates?: 3607773..3608123
  • synteny block?: BlockID0023110
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0988
    08BA02176:
    C248_1058
    11819-97:
    MS7_0990
    71193:
    ST398NM01_1031
    ECT-R 2:
    ECTR2_889
    ED133:
    SAOV_0979
    ED98:
    SAAV_0997
    HO 5096 0412:
    SAEMRSA15_08640
    JH1:
    SaurJH1_1115
    JH9:
    SaurJH9_1093
    JKD6008:
    SAA6008_00987
    JKD6159:
    SAA6159_00889
    LGA251:
    SARLGA251_09480
    M013:
    M013TW_0963
    MRSA252:
    SAR1004
    MSHR1132:
    SAMSHR1132_08810
    MSSA476:
    SAS0968
    Mu3:
    SAHV_1028
    Mu50:
    SAV1035
    MW2:
    MW0916
    RF122:
    SAB0898
    ST398:
    SAPIG1031
    T0131:
    SAT0131_01067
    TCH60:
    HMPREF0772_12202
    TW20:
    SATW20_10300
    USA300_TCH1516:
    VC40:
    SAVC_04330

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIELKDLTIQKGNTHILKKLNLKFQCGKSYALIGKSGCGKSTLLNTIAGLEKTGKQYVYF
    N315            MIELKDLTIQKGNIHILKKLNLKFQCGKSYALIGKSGCGKSTLLNTIAGLEKTGKQYVYF
    NCTC8325        MIELKDLTIQKGNTHILKKLNLKFQCGKSYALIGKSGCGKSTLLNTIAGLEKTGKQYVYF
    Newman          MIELKDLTIQKGNTHILKKLNLKFQCGKSYALIGKSGCGKSTLLNTIAGLEKTGKQYVYF
    USA300_FPR3757  MIELKDLTIQKGNTHILKKLNLKFQCGKSYALIGKSGCGKSTLLNTIAGLEKTGKQYVYF
                    ************* **********************************************

    COL             NGQLEQFKSNFYRDKLGYLFQNYGLIDNLTVNENLDIGLAYKKISKKEKEQIKIRYIEQF
    N315            NGQLEQFKSNFYRDKLGYLFQNYGLIDNLTVNENLDIGLAYKKISKKEKEQLKIRYIEQF
    NCTC8325        NGQLEQFKSNFYRDKLGYLFQNYGLIDNLTVNENLDIGLAYKKISKKEKEQIKIRYIEQF
    Newman          NGQLEQFKSNFYRDKLGYLFQNYGLIDNLTVNENLDIGLAYKKISKKEKEQIKIRYIEQF
    USA300_FPR3757  NGQLEQFKSNFYRDKLGYLFQNYGLIDNLTVNENLDIGLAYKKISKKEKEQIKIRYIEQF
                    ***************************************************:********

    COL             GLSNSLKRKVHTLSGGEQQRVALIRMMLKDPIVMLADEPTGALDPKTGQMIIQSLFGLVD
    N315            GLSNSLKRKVHTLSGGEQQRVALIRMMLKDPIVMLADEPTGALDPKTGQMIIQSLFDLVD
    NCTC8325        GLSNSLKRKVHTLSGGEQQRVALIRMMLKDPIVMLADEPTGALDPKTGQMIIQSLFGLVD
    Newman          GLSNSLKRKVHTLSGGEQQRVALIRMMLKDPIVMLADEPTGALDPKTGQMIIQSLFGLVD
    USA300_FPR3757  GLSNSLKRKVHTLSGGEQQRVALIRMMLKDPIVMLADEPTGALDPKTGQMIIQSLFGLVD
                    ********************************************************.***

    COL             ENKVLILATHDMAIANQCDEIIDLEQYRKVASM
    N315            ENKVLILATHDMAIANQCDEIIDLEQYSKVASM
    NCTC8325        ENKVLILATHDMAIANQCDEIIDLEQYRKVASM
    Newman          ENKVLILATHDMAIANQCDEIIDLEQYRKVASM
    USA300_FPR3757  ENKVLILATHDMAIANQCDEIIDLEQYRKVASM
                    *************************** *****