From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003229000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • phage protein
  • strand?: -
  • coordinates?: 3610707..3610895
  • synteny block?: BlockID0023130
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0989
    08BA02176:
    C248_1059
    11819-97:
    MS7_0991
    71193:
    ST398NM01_1032
    ECT-R 2:
    ECTR2_890
    ED133:
    SAOV_0980c
    ED98:
    SAAV_0998
    HO 5096 0412:
    SAEMRSA15_08670
    JH1:
    SaurJH1_1116
    JH9:
    SaurJH9_1094
    JKD6008:
    SAA6008_00988
    JKD6159:
    SAA6159_00890
    LGA251:
    SARLGA251_09490
    M013:
    M013TW_0964
    MRSA252:
    SAR1005
    MSHR1132:
    MSSA476:
    SAS0969
    Mu3:
    SAHV_1029
    Mu50:
    SAV1036
    MW2:
    MW0917
    RF122:
    SAB0899c
    ST398:
    SAPIG1032
    T0131:
    SAT0131_01068
    TCH60:
    HMPREF0772_12201
    TW20:
    USA300_TCH1516:
    VC40:
    SAVC_04335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFYACHFKVKIGGVILTRTYNIIGILSCLISFIIMALPMIWYTASALWFFPGAIMILLLS
    N315            ---------------MTRTYNIIGILSCLISFIIMALPMIWYTASALWFFPGAIMILLLS
    NCTC8325        MFYACHFKVKIGGVILTRTYNIIGILSCLISFIIMALPMIWYTASALWFFPGAIMILLLS
    Newman          MFYACHFKVKIGGVILTRTYNIIGILSCLISFIIMALPMIWYTASALWFFPGAIMILLLS
    USA300_FPR3757  MFYACHFKVKIGGVILTRTYNIIGILSCLISFIIMALPMIWYTASALWFFPGAIMILLLS
                                   :********************************************

    COL             LVIVFCYIKTKNQLHLLLIVLNIIILLFFSLPLLLS
    N315            LVIVFCYIKTKNQLHLLLIVLNIIILLFFSLPLLLS
    NCTC8325        LVIVFCYIKTKNQLHLLLIVLNIIILLFFSLPLLLS
    Newman          LVIVFCYIKTKNQLHLLLIVLNIIILLFFSLPLLLS
    USA300_FPR3757  LVIVFCYIKTKNQLHLLLIVLNIIILLFFSLPLLLS
                    ************************************