From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003254000
  • symbol?: patA
  • description?: HisC-like protein

      descriptions from strain specific annotations:

    • HisC-like protein
    • class I and II aminotransferase
    • aminotransferase, class I
    • N-acetyl-L,L-diaminopimelate aminotransferase
    • putative aminotransferase A
    • aromatic amino acid transferase
    • aspartate transaminase
    • Aromatic amino acid aminotransferase
  • strand?: -
  • coordinates?: 3629313..3630467
  • synteny block?: BlockID0023380
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1004
    08BA02176:
    C248_1075
    11819-97:
    MS7_1007 (patA)
    71193:
    ST398NM01_1047
    ECT-R 2:
    ECTR2_905
    ED133:
    SAOV_0996c
    ED98:
    SAAV_1014
    HO 5096 0412:
    SAEMRSA15_08810
    JH1:
    SaurJH1_1131
    JH9:
    SaurJH9_1108
    JKD6008:
    SAA6008_01004
    JKD6159:
    SAA6159_00906
    LGA251:
    SARLGA251_09640
    M013:
    M013TW_0979
    MRSA252:
    SAR1023
    MSHR1132:
    SAMSHR1132_08980
    MSSA476:
    SAS0985
    Mu3:
    SAHV_1042
    Mu50:
    SAV1049
    MW2:
    MW0933
    RF122:
    SAB0917c
    ST398:
    SAPIG1047
    T0131:
    SAT0131_01084
    TCH60:
    HMPREF0772_12184 (aspC)
    TW20:
    SATW20_10460
    USA300_TCH1516:
    VC40:
    SAVC_04415

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLSLNSNSKYLRAPSIRQFSNRMNNLDDCVNLTIGQPDFPMPDVVKKAYIDAINNDKTS
    N315            MKLSLNSNSKYLRAPSIRQFSNRMNNLDDCVNLTIGQPDFPMPDVVKKAYIDAINNDKTS
    NCTC8325        MKLSLNSNSKYLRAPSIRQFSNRMNNLDDCVNLTIGQPDFPMPDVVKKAYIDAINNDKTS
    Newman          MKLSLNSNSKYLRAPSIRQFSNRMNNLDDCVNLTIGQPDFPMPDVVKKAYIDAINNDKTS
    USA300_FPR3757  MKLSLNSNSKYLRAPSIRQFSNRMNNLDDCVNLTIGQPDFPMPDVVKKAYIDAINNDKTS
                    ************************************************************

    COL             YSHNKGLLETREAISQYFKNRYHFSYDPEEIIVTNGASEAIDTTLRSIIEPGDEIIIPGP
    N315            YSHNKGLLETREAISQYFKNRYHFSYDPEEIIVTNGASEAIDTTLRSIIEPGDEIIIPGP
    NCTC8325        YSHNKGLLETREAISQYFKNRYHFSYDPEEIIVTNGASEAIDTTLRSIIEPGDEIIIPGP
    Newman          YSHNKGLLETREAISQYFKNRYHFSYDPEEIIVTNGASEAIDTTLRSIIEPGDEIIIPGP
    USA300_FPR3757  YSHNKGLLETREAISQYFKNRYHFSYDPEEIIVTNGASEAIDTTLRSIIEPGDEIIIPGP
                    ************************************************************

    COL             IYAGYIPLIEVLGGKPIYIDTTATQFKITPDALESHISPKTKAVLLNYPTNPTGVVLKRN
    N315            IYAGYIPLIEVLGGKPIYIDTTATQFKITPDALESHISPKTKAVLLNYPTNPTGVVLKRN
    NCTC8325        IYAGYIPLIEVLGGKPIYIDTTATQFKITPDALESHISPKTKAVLLNYPTNPTGVVLKRN
    Newman          IYAGYIPLIEVLGGKPIYIDTTATQFKITPDALESHISPKTKAVLLNYPTNPTGVVLKRN
    USA300_FPR3757  IYAGYIPLIEVLGGKPIYIDTTATQFKITPDALESHISPKTKAVLLNYPTNPTGVVLKRN
                    ************************************************************

    COL             EVLNIVNVLKKYPLFIISDEIYAENTFSGKHVSFAEFEDIRDQLILIGGLSKSHSATGIR
    N315            EVLNIVNVLKKYPIFIISDEIYAENTFSGKHVSFAEFEDIRDQLILIGGLSKSHSATGIR
    NCTC8325        EVLNIVNVLKKYPLFIISDEIYAENTFSGKHVSFAEFEDIRDQLILIGGLSKSHSATGIR
    Newman          EVLNIVNVLKKYPLFIISDEIYAENTFSGKHVSFAEFEDIRDQLILIGGLSKSHSATGIR
    USA300_FPR3757  EVLNIVNVLKKYPLFIISDEIYAENTFSGKHVSFAEFEDIRDQLILIGGLSKSHSATGIR
                    *************:**********************************************

    COL             IGFLLGPQYLIDKLTFMHAYNCICANVPAQIACITALNEGLEAPKYMNEAYVERRNYLVS
    N315            IGFLLGPQYLIDKLTFMHAYNCICANVPAQIACITALNEGLEAPKYMNEAYVERRNYLVS
    NCTC8325        IGFLLGPQYLIDKLTFMHAYNCIFANVPAQIACITALNEGLEAPKYMNEAYVERRNYLVS
    Newman          IGFLLGPQYLIDKLTFMHAYNCICANVPAQIACITALNEGLEAPKYMNEAYVERRNYLVS
    USA300_FPR3757  IGFLLGPQYLIDKLTFMHAYNCICANVPAQIACITALNEGLEAPKYMNEAYVERRNYLVS
                    *********************** ************************************

    COL             ELTKLGFEITAQPEGAFYIFPSIKHITDDDFEFCVDLLESTHLAIVPGSSFTEFGKGFVR
    N315            ELTKLGFEITAQPEGAFYIFPSIKHITDDDFEFCVDLLESTHLAIVPGSSFTEFGKGFVR
    NCTC8325        ELTKLGFEITAQPEGAFYIFPSIKHITDDDFEFCVDLLESTHLAIVPGSSFTEFGKGFVR
    Newman          ELTKLGFEITAQPEGAFYIFPSIKHITDDDFEFCVDLLESTHLAIVPGSSFTEFGKGFVR
    USA300_FPR3757  ELTKLGFEITAQPEGAFYIFPSIKHITDDDFEFCVDLLESTHLAIVPGSSFTEFGKGFVR
                    ************************************************************

    COL             ISYAYEMDVLKEGMKRLAKYLNTK
    N315            ISYAYEMDVLKEGMKRLAKYLNTK
    NCTC8325        ISYAYEMDVLKEGMKRLAKYLNTK
    Newman          ISYAYEMDVLKEGMKRLAKYLNTK
    USA300_FPR3757  ISYAYEMDVLKEGMKRLAKYLNTK
                    ************************