From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003257000
  • symbol?:
  • description?: acyltransferase 3

      descriptions from strain specific annotations:

    • acyltransferase 3
    • acyltransferase family protein
    • putative acetyltransferase
    • acyltransferases family protein
    • Permease
    • membrane protein
    • pseudogene
  • strand?: -
  • coordinates?: 3631323..3632335
  • synteny block?: BlockID0023410
  • occurrence?: in 88% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1005
    08BA02176:
    C248_1076
    11819-97:
    MS7_1008
    71193:
    ST398NM01_1048
    ECT-R 2:
    ECTR2_906
    ED133:
    SAOV_0997c
    ED98:
    SAAV_1015
    HO 5096 0412:
    SAEMRSA15_08820
    JH1:
    SaurJH1_1132
    JH9:
    SaurJH9_1109
    JKD6008:
    SAA6008_01005
    JKD6159:
    LGA251:
    SARLGA251_09650
    M013:
    MRSA252:
    SAR1024
    MSHR1132:
    MSSA476:
    SAS0986
    Mu3:
    SAHV_1043
    Mu50:
    SAV1050
    MW2:
    MW0934
    RF122:
    SAB0918c
    ST398:
    SAPIG1048
    T0131:
    SAT0131_01085
    TCH60:
    HMPREF0772_12183
    TW20:
    SATW20_10470
    USA300_TCH1516:
    VC40:
    SAVC_04420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
    N315            MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
    NCTC8325        MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
    Newman          MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
    USA300_FPR3757  MTSLKERDYFFDNARAILILLVVFGHMLQPYTSGDKYLSALYLVIYSFHMPTFLFISGYF
                    ************************************************************

    COL             AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
    N315            AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
    NCTC8325        AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
    Newman          AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
    USA300_FPR3757  AKNIDKPYYLEKISKRLIVPYMIFFAFFSIYYFLTGKSDELQLDPFNPVFALWFLITLFF
                    ************************************************************

    COL             FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
    N315            FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
    NCTC8325        FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
    Newman          FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
    USA300_FPR3757  FHVILVIVRRFNPYKVLSVSIIISIGAGFSDNIDSYLSISRTIVFFPIFYLGYIFTKKHT
                    ************************************************************

    COL             AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
    N315            AIFKNKKLIPVSIITFILFFIIYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
    NCTC8325        AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
    Newman          AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
    USA300_FPR3757  AIFKNKKLIPVSIITFILFFIVYVIHPINADWLLGSSPYTSLENEGQSIFSPFKRLILYG
                    *********************:**************************************

    COL             IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
    N315            IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
    NCTC8325        IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
    Newman          IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
    USA300_FPR3757  IILIAMTAFLNLMSTKKKLYTYIGSRTLYVYLLHGLIIGIVRGFEWYPFDNPISLMTYLY
                    ************************************************************

    COL             LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS
    N315            LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS
    NCTC8325        LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS
    Newman          LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS
    USA300_FPR3757  LISISVIIVYVLSTNFVCKWTNPIINLQRPSQFKDS
                    ************************************