From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003264000
  • symbol?:
  • description?: Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily F2

      descriptions from strain specific annotations:

    • Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily F2
    • cell envelope-related function transcriptional attenuator common domain-containing protein
    • cell envelope-related transcriptional attenuator domain family
    • cell envelope transcriptional attenuator
    • exported protein
    • LytR family transcriptional regulator
  • strand?: -
  • coordinates?: 3639826..3641032
  • synteny block?: BlockID0023480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1010
    08BA02176:
    C248_1081
    11819-97:
    MS7_1013
    71193:
    ST398NM01_1053
    ECT-R 2:
    ECTR2_911
    ED133:
    SAOV_1002c
    ED98:
    SAAV_1020
    HO 5096 0412:
    SAEMRSA15_08870
    JH1:
    SaurJH1_1138
    JH9:
    SaurJH9_1115
    JKD6008:
    SAA6008_01011
    JKD6159:
    SAA6159_00912
    LGA251:
    SARLGA251_09700
    M013:
    M013TW_0987
    MRSA252:
    SAR1029
    MSHR1132:
    SAMSHR1132_09040
    MSSA476:
    SAS0991
    Mu3:
    SAHV_1048
    Mu50:
    SAV1056
    MW2:
    MW0939
    RF122:
    SAB0922c
    ST398:
    SAPIG1053
    T0131:
    SAT0131_01090 (nanE)
    TCH60:
    HMPREF0772_12178
    TW20:
    SATW20_10520
    USA300_TCH1516:
    USA300HOU_1000
    VC40:
    SAVC_04445

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKFLKYFLILLALVLIVVPIVFATLLFKTSQDAFESSQDSKNANRQSNLRDNKVNPEEQ
    N315            MNKFLKYFLILLALVLIVVPIVFATLLFKTSQDAFESSQDSKNANRQSNLRDNKVNPEEQ
    NCTC8325        MNKFLKYFLILLALVLIVVPIVFATLLFKTSQDAFESSQDSKNANRQSNLRDNKVNPEEQ
    Newman          MNKFLKYFLILLALVLIVVPIVFATLLFKTSQDAFESSQDSKNANRQSNLRDNKVNPEEQ
    USA300_FPR3757  MNKFLKYFLILLALVLIVVPIVFATLLFKTSQDAFESSQDSKNANRQSNLRDNKVNPEEQ
                    ************************************************************

    COL             PISILFLGIDDNDGRRKKGQDAEHSRSDAMILTTFNQSKHQIRMLSIPRDTISYIPKVGY
    N315            PISILFLGIDDNDGRRKKGQDAEHSRSDAMILTTFNQSKHQIRMLSIPRDTISYIPKVGY
    NCTC8325        PISILFLGIDDNDGRRKKGQDAEHSRSDAMILTTFNQSKHQIRMLSIPRDTISYIPKVGY
    Newman          PISILFLGIDDNDGRRKKGQDAEHSRSDAMILTTFNQSKHQIRMLSIPRDTISYIPKVGY
    USA300_FPR3757  PISILFLGIDDNDGRRKKGQDAEHSRSDAMILTTFNQSKHQIRMLSIPRDTISYIPKVGY
                    ************************************************************

    COL             YDKITHAHAYGGPIAAMDSVEATMNVPVDYYVRVNMKAFVEAVNELGGIYYDVPYDLNEP
    N315            YDKITHAHAYGGPIAAMDSVEATMNVPVDYYVRVNMKAFVEAVNELGGIYYDVPYDLNEP
    NCTC8325        YDKITHAHAYGGPIAAMDSVEATMNVPVDYYVRVNMKAFVEAVNELGGIYYDVPYDLNEP
    Newman          YDKITHAHAYGGPIAAMDSVEATMNVPVDYYVRVNMKAFVEAVNELGGIYYDVPYDLNEP
    USA300_FPR3757  YDKITHAHAYGGPIAAMDSVEATMNVPVDYYVRVNMKAFVEAVNELGGIYYDVPYDLNEP
                    ************************************************************

    COL             NTDDTGKIKIKKGYQKLNGDEALAVARTRHHDSDLKRGQRQMELIKILFQKAQEVDSIDK
    N315            NTDDTGKIKIKKGYQKLNGDEALAVARTRHHDSDLKRGQRQMELIKILFQKAQEVDSIDK
    NCTC8325        NTDDTGKIKIKKGYQKLNGDEALAVARTRHHDSDLKRGQRQMELIKILFQKAQEVDSIDK
    Newman          NTDDTGKIKIKKGYQKLNGDEALAVARTRHHDSDLKRGQRQMELIKILFQKAQEVDSIDK
    USA300_FPR3757  NTDDTGKIKIKKGYQKLNGDEALAVARTRHHDSDLKRGQRQMELIKILFQKAQEVDSIDK
                    ************************************************************

    COL             LDNVIQIVGKNAKHNLTNSEIKALAKMYLTNDVEIKTAQLKGKDDMLNGIYYYHPSVESI
    N315            LDNVIQIVGKNAKHNLTNSEIKALAKMYLTNDVEIKTAQLKGKDDMLNGIYYYHPSVESI
    NCTC8325        LDNVIQIVGKNAKHNLTNSEIKALAKMYLTNDVEIKTAQLKGKDDMLNGIYYYHPSVESI
    Newman          LDNVIQIVGKNAKHNLTNSEIKALAKMYLTNDVEIKTAQLKGKDDMLNGIYYYHPSVESI
    USA300_FPR3757  LDNVIQIVGKNAKHNLTNSEIKALAKMYLTNDVEIKTAQLKGKDDMLNGIYYYHPSVESI
                    ************************************************************

    COL             QKYANLLRKDLELSPINDKNDFLDQRVINHYGSLIPLTPLDNSLLRKEQNDTTDKDKTSN
    N315            QKYANLLRKDLELSPINDKNDFLDQRVINHYGSLIPLTPLDSSLLRKEQNDTTDKDKTSN
    NCTC8325        QKYANLLRKDLELSPINDKNDFLDQRVINHYGSLIPLTPLDNSLLRKEQNDTTDKDKTSN
    Newman          QKYANLLRKDLELSPINDKNDFLDQRVINHYGSLIPLTPLDNSLLRKEQNDTTDKDKTSN
    USA300_FPR3757  QKYANLLRKDLELSPINDKNDFLDQRVINHYGSLIPLTPLDNSLLRKEQNDTTDKDKTSN
                    *****************************************.******************

    COL             ENSDSTNNSDSSNQQQPATDQNSNQNQGGTQQAPQASNNQNGVVN
    N315            ENNDSTNNSDSSNQQQPATDQNLNQNQGGTQQAPQASNNQNGVVN
    NCTC8325        ENSDSTNNSDSSNQQQPATDQNSNQNQGGTQQAPQASNNQNGVVN
    Newman          ENSDSTNNSDSSNQQQPATDQNSNQNQGGTQQAPQASNNQNGVVN
    USA300_FPR3757  ENSDSTNNSDSSNQQQPATDQNSNQNQGGTQQAPQASNNQNGVVN
                    **.******************* **********************