From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003277000
  • symbol?: purE
  • description?: phosphoribosylaminoimidazole carboxylase

      descriptions from strain specific annotations:

    • phosphoribosylaminoimidazole carboxylase
    • phosphoribosylaminoimidazole carboxylase, catalytic subunit
    • phosphoribosylaminoimidazole carboxylase catalytic subunit
    • phosphoribosylaminoimidazole carboxylase catalytic subunit (AIR carboxylase) (AIRC)
    • 5-(carboxyamino)imidazole ribonucleotide mutase
    • putative phosphoribosylaminoimidazolecarboxylase catalytic subunit
    • phosphoribosylaminoimidazole carboxylase catalytic subunit PurE
    • phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit
  • strand?: +
  • coordinates?: 3652462..3652953
  • synteny block?: BlockID0023610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1073 (purE)
    N315:
    NCTC8325:
    Newman:
    NWMN_0933 (purE)
    USA300_FPR3757:
    04-02981:
    SA2981_1020 (purE)
    08BA02176:
    C248_1089 (purE)
    11819-97:
    MS7_1022 (purE)
    71193:
    ST398NM01_1062
    ECT-R 2:
    ECTR2_920 (purE)
    ED133:
    SAOV_1010
    ED98:
    SAAV_1029 (purE)
    HO 5096 0412:
    SAEMRSA15_08950 (purE)
    JH1:
    SaurJH1_1146
    JH9:
    SaurJH9_1124
    JKD6008:
    SAA6008_01020 (purE)
    JKD6159:
    SAA6159_00920 (purE)
    LGA251:
    SARLGA251_09780 (purE)
    M013:
    M013TW_0996
    MRSA252:
    SAR1038 (purE)
    MSHR1132:
    SAMSHR1132_09120
    MSSA476:
    SAS1000
    Mu3:
    SAHV_1056
    Mu50:
    SAV1064
    MW2:
    MW0947
    RF122:
    SAB0931 (purE)
    ST398:
    SAPIG1062 (purE)
    T0131:
    SAT0131_01100
    TCH60:
    HMPREF0772_12169 (purE)
    TW20:
    SATW20_10600 (purE)
    USA300_TCH1516:
    USA300HOU_1009 (purE)
    VC40:
    SAVC_04485

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVAVIMGSSSDWKIMQESCNMLDYFEIPYEKQVVSAHRTPKMMVQFASEARERGINIII
    N315            MKVAVIMGSSSDWKIMQESCNMLDYFEIPYEKQVVSAHRTPKMMVQFASEARERGINIII
    NCTC8325        ---------------------MLDYFEIPYEKQVVSAHRTPKMMVQFASEARERGINIII
    Newman          MKVAVIMGSSSDWKIMQESCNMLDYFEIPYEKQVVSAHRTPKMMVQFASEARERGINIII
    USA300_FPR3757  ---------------------MLDYFEIPYEKQVVSAHRTPKMMVQFASEARERGINIII
                                         ***************************************

    COL             AGAGGAAHLPGMVASLTTLPVIGVPIETKSLKGIDSLLSIVQMPGGIPVATTAIGAAGAK
    N315            AGAGGAAHLPGMVASLTTLPVIGVPIETKSLKGIDSLLSIVQMPGGIPVATTAIGAAGAK
    NCTC8325        AGAGGAAHLPGMVASLTTLPVIGVPIETKSLKGIDSLLSIVQMPGGIPVATTAIGAAGAK
    Newman          AGAGGAAHLPGMVASLTTLPVIGVPIETKSLKGIDSLLSIVQMPGGIPVATTAIGAAGAK
    USA300_FPR3757  AGAGGAAHLPGMVASLTTLPVIGVPIETKSLKGIDSLLSIVQMPGGIPVATTAIGAAGAK
                    ************************************************************

    COL             NAGILAARMLSIQNPSLVEKLNQYESSLIQKVEDMQNELQ
    N315            NAGILAARMLSIQNPSLVEKLNQYESSLIQKVEDMQNELQ
    NCTC8325        NAGILAARMLSIQNPSLVEKLNQYESSLIQKVEDMQNELQ
    Newman          NAGILAARMLSIQNPSLVEKLNQYESSLIQKVEDMQNELQ
    USA300_FPR3757  NAGILAARMLSIQNPSLVEKLNQYESSLIQKVEDMQNELQ
                    ****************************************