From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003278000
  • symbol?: purK
  • description?: 5-(carboxyamino)imidazole ribonucleotide synthase

      descriptions from strain specific annotations:

    • 5-(carboxyamino)imidazole ribonucleotide synthase
    • phosphoribosylaminoimidazole carboxylase ATPase subunit
    • putative phosphoribosylaminoimidazolecarboxylase ATPase subunit
    • N5-carboxyaminoimidazole ribonucleotide synthase
    • phosphoribosylaminoimidazole carboxylase, ATPase subunit
    • phosphoribosylaminoimidazole carboxylase ATPase subunit PurK
    • phosphoribosylaminoimidazole carboxylase NCAIR mutase subunit
    • phosphoribosylaminoimidazolesuccinocarboxamide synthase
  • strand?: +
  • coordinates?: 3652940..3654064
  • synteny block?: BlockID0023620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1074 (purK)
    N315:
    SA0917 (purK)
    NCTC8325:
    Newman:
    NWMN_0934 (purK)
    USA300_FPR3757:
    04-02981:
    SA2981_1021 (purK)
    08BA02176:
    C248_1090 (purK)
    11819-97:
    MS7_1023 (purK)
    71193:
    ST398NM01_1063
    ECT-R 2:
    ECTR2_921 (purK)
    ED133:
    SAOV_1011
    ED98:
    SAAV_1030 (purK)
    HO 5096 0412:
    SAEMRSA15_08960 (purK)
    JH1:
    SaurJH1_1147
    JH9:
    SaurJH9_1125
    JKD6008:
    SAA6008_01021 (purK)
    JKD6159:
    SAA6159_00921 (purK)
    LGA251:
    SARLGA251_09790 (purK)
    M013:
    M013TW_0997
    MRSA252:
    SAR1039 (purK)
    MSHR1132:
    SAMSHR1132_09130
    MSSA476:
    SAS1001
    Mu3:
    SAHV_1057 (purK)
    Mu50:
    SAV1065 (purK)
    MW2:
    MW0948 (purK)
    RF122:
    SAB0932 (purK)
    ST398:
    SAPIG1063 (purK)
    T0131:
    SAT0131_01101 (rocF)
    TCH60:
    HMPREF0772_12168 (purK)
    TW20:
    SATW20_10610 (purK)
    USA300_TCH1516:
    USA300HOU_1010 (purK)
    VC40:
    SAVC_04490

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNFNKLKFGATIGIIGGGQLGKMMAQSAQKMGYKVVVLDPSEDCPCRYVAHEFIQAKYDD
    N315            MNFNKLKFGATIGIIGGGQLGKMMAQSAQKMGYKVVVLDPSEDCPCRYVAHEFIQAKYDD
    NCTC8325        MNFNKLKFGATIGIIGGGQLGKMMAQSAQKMGYKVVVLDPSEDCPCRYVAHEFIQAKYDD
    Newman          MNFNKLKFGATIGIIGGGQLGKMMAQSAQKMGYKVVVLDPSEDCPCRYVAHEFIQAKYDD
    USA300_FPR3757  MNFNKLKFGATIGIIGGGQLGKMMAQSAQKMGYKVVVLDPSEDCPCRYVAHEFIQAKYDD
                    ************************************************************

    COL             EKALNQLGQKCDVITYEFENISAQQLKLLCEKYNIPQGYQAIQLLQDRLTEKETLKSAGT
    N315            EKALNQLGQKCDVITYEFENISAQQLKLLCEKYNIPQGYQAIQLLQDRLTEKETLKSAGT
    NCTC8325        EKALNQLGQKCDVITYEFENISAQQLKLLCEKYNIPQGYQAIQLLQDRLTEKETLKSAGT
    Newman          EKALNQLGQKCDVITYEFENISAQQLKLLCEKYNIPQGYQAIQLLQDRLTEKETLKSAGT
    USA300_FPR3757  EKALNQLGQKCDVITYEFENISAQQLKLLCEKYNIPQGYQAIQLLQDRLTEKETLKSAGT
                    ************************************************************

    COL             KVVPFISVKESTDIDKAIETLGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC
    N315            KVVPFISVKESTDIDKAIETLGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC
    NCTC8325        KVVPFISVKESTDIDKAIETLGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC
    Newman          KVVPFISVKESTDIDKAIETLGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC
    USA300_FPR3757  KVVPFISVKESTDIDKAIETLGYPFIVKTRFGGYDGKGQVLINNEKDLQEGFKLIETSEC
                    ************************************************************

    COL             VAEKYLNIKKEVSLTVTRGNNNQITFFPLQENEHRNQILFKTIVPARIDKTAEAKEQVNK
    N315            VAEKYLNIKKEVSLTVTRGNNNQITFFPLQENEHRNQILFKTIVPARIDKTAEAKEQVNK
    NCTC8325        VAEKYLNIKKEVSLTVTRGNNNQITFFPLQENEHRNQILFKTIVPARIDKTAEAKEQVNK
    Newman          VAEKYLNIKKEVSLTVTRGNNNQITFFPLQENEHRNQILFKTIVPARIDKTAEAKEQVNK
    USA300_FPR3757  VAEKYLNIKKEVSLTVTRGNNNQITFFPLQENEHRNQILFKTIVPARIDKTAEAKEQVNK
                    ************************************************************

    COL             IIQSIHFIGTFTVEFFIDSNNQLYVNEIAPRPHNSGHYSIEACDYSQFDTHILAVTGQSL
    N315            IIQSIHFIGTFTVEFFIDSNNQLYVNEIAPRPHNSGHYSIEACDYSQFDTHILAVTGQSL
    NCTC8325        IIQSIHFIGTFTVEFFIDSNNQLYVNEIAPRPHNSGHYSIEACDYSQFDTHILAVTGQSL
    Newman          IIQSIHFIGTFTVEFFIDSNNQLYVNEIAPRPHNSGHYSIEACDYSQFDTHILAVTGQSL
    USA300_FPR3757  IIQSIHFIGTFTVEFFIDSNNQLYVNEIAPRPHNSGHYSIEACDYSQFDTHILAVTGQSL
                    ************************************************************

    COL             PNSIELLKPAVMMNLLGKDLDLLENEFNEHPEWHLHIYGKSERKDSRKMGHMTVLTNDVN
    N315            PNSIELLKPAVMMNLLGKDLDLLENEFNEHPEWHLHIYGKSGRKDSRKMGHMTVLTNDVN
    NCTC8325        PNSIELLKPAVMMNLLGKDLDLLENEFNEHPEWHLHIYGKSERKDSRKMGHMTVLTNDVN
    Newman          PNSIELLKPAVMMNLLGKDLDLLENEFNEHPEWHLHIYGKSERKDSRKMGHMTVLTNDVN
    USA300_FPR3757  PNSIELLKPAVMMNLLGKDLDLLENEFNEHPEWHLHIYGKSERKDSRKMGHMTVLTNDVN
                    ***************************************** ******************

    COL             QTEQDMYAKFEGSN
    N315            QTEQDMYAKFEGSN
    NCTC8325        QTEQDMYAKFEGSN
    Newman          QTEQDMYAKFEGSN
    USA300_FPR3757  QTEQDMYAKFEGSN
                    **************