From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003281000
  • symbol?: purQ
  • description?: phosphoribosylformylglycinamidine synthase I

      descriptions from strain specific annotations:

    • phosphoribosylformylglycinamidine synthase I
    • phosphoribosylformylglycinamidine synthase subunit PurQ
    • Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit
    • putative phosphoribosylformylglycinamidinesynthase I
    • Phosphoribosylformylglycinamidine synthase 1
  • strand?: +
  • coordinates?: 3655016..3655708
  • synteny block?: BlockID0023650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1077 (purQ)
    N315:
    SA0920 (purQ)
    NCTC8325:
    Newman:
    NWMN_0936 (purQ)
    USA300_FPR3757:
    04-02981:
    SA2981_1024 (purQ)
    08BA02176:
    C248_1093 (purQ)
    11819-97:
    MS7_1026 (purQ)
    71193:
    ST398NM01_1066
    ECT-R 2:
    ECTR2_924 (purQ)
    ED133:
    SAOV_1013
    ED98:
    SAAV_1033 (purQ)
    HO 5096 0412:
    SAEMRSA15_08990 (purQ)
    JH1:
    SaurJH1_1150
    JH9:
    SaurJH9_1128
    JKD6008:
    SAA6008_01024 (purQ)
    JKD6159:
    SAA6159_00924 (purQ)
    LGA251:
    SARLGA251_09820 (purQ)
    M013:
    M013TW_1000
    MRSA252:
    SAR1042 (purQ)
    MSHR1132:
    SAMSHR1132_09160
    MSSA476:
    SAS1004
    Mu3:
    SAHV_1060 (purQ)
    Mu50:
    SAV1068 (purQ)
    MW2:
    MW0951 (purQ)
    RF122:
    SAB0935 (purQ)
    ST398:
    SAPIG1066 (purQ)
    T0131:
    SAT0131_01104
    TCH60:
    HMPREF0772_12165 (purQ)
    TW20:
    SATW20_10640 (purQ)
    USA300_TCH1516:
    USA300HOU_1013 (purQ)
    VC40:
    SAVC_04505

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGA
    N315            MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGA
    NCTC8325        MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGA
    Newman          MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGA
    USA300_FPR3757  MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGA
                    ************************************************************

    COL             MASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVN
    N315            MASVAPIISEVKRLATEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVN
    NCTC8325        MASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVN
    Newman          MASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVN
    USA300_FPR3757  MASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVN
                    ***************:********************************************

    COL             NQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGI
    N315            NQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGI
    NCTC8325        NQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGI
    Newman          NQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGI
    USA300_FPR3757  NQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGI
                    ************************************************************

    COL             VNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV
    N315            VNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV
    NCTC8325        VNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV
    Newman          VNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV
    USA300_FPR3757  VNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV
                    *******************************************