From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01012
  • pan locus tag?: SAUPAN003281000
  • symbol: SAOUHSC_01012
  • pan gene symbol?: purQ
  • synonym:
  • product: phosphoribosylformylglycinamidine synthase I

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01012
  • symbol: SAOUHSC_01012
  • product: phosphoribosylformylglycinamidine synthase I
  • replicon: chromosome
  • strand: +
  • coordinates: 981888..982559
  • length: 672
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAATTTGCGGTTCTTGTTTTTCCAGGTTCGAATTGTGATAGAGACATGTTTAATGCT
    GCTATTAAAAGTGGTGTTGAAGCGGAATATGTAGATTATAGAGAAACATCACTAAGTGGA
    TTTGATGGCGTACTTATTCCTGGTGGATTTTCATTCGGGGATTACTTAAGATCTGGGGCA
    ATGGCTAGTGTAGCGCCGATTATTTCGGAAGTTAAACGTCTTGCAGCTGAAGGTAAGCCA
    GTATTAGGTGTTTGTAATGGGTTTCAAATTTTAACTGAAATAGGCTTATTACCTGGTGCA
    TTATTGCATAACGATTCACATTTATTTATTAGTAGAAATGAAGAGTTAGAAATAGTGAAT
    AATCAAACGGCATTTACAAATCTTTATGAACAAGGTGAAAAAGTTATATATCCTGTAGCT
    CACGGTGAAGGTCATTATTATTGTACTGATGAAATATATCAACAATTAAAAGCTAACAAT
    CAAATTATTCTGAAATATGTGAATAATCCGAACGGTTCATATGATGATATTGCAGGAATT
    GTTAACGAAAAAGGCAATGTATGTGGCATGATGCCACATCCTGAAAGAGCTTTAGAAACG
    TTGTTAGGTACTGATAGTGGTGTGAAATTATTTGAAGCGATGGTAAAAAGTTGGAGGGAA
    CAACATGTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    672

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01012
  • symbol: SAOUHSC_01012
  • description: phosphoribosylformylglycinamidine synthase I
  • length: 223
  • theoretical pI: 4.69597
  • theoretical MW: 24526.7
  • GRAVY: -0.108969

Function[edit source | edit]

  • reaction:
    EC 6.3.5.3?  ExPASy
    Phosphoribosylformylglycinamidine synthaseATP + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide + L-glutamine + H2O = ADP + phosphate + 2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine + L-glutamate
    EC 3.5.1.2?  ExPASy
    GlutaminaseL-glutamine + H2O = L-glutamate + NH3
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 325.8)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase (TIGR01857; EC 6.3.5.3; HMM-score: 83.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase (TIGR01735; EC 6.3.5.3; HMM-score: 76.2)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesintracellular protease, PfpI family (TIGR01382; HMM-score: 25.8)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 25.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 21.8)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesisCTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 17.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobyric acid synthase CobQ (TIGR00313; EC 6.3.5.10; HMM-score: 17.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisGMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 16.2)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesiscarbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 13.2)
    aminodeoxychorismate synthase (TIGR01823; EC 2.6.1.85; HMM-score: 10.2)
  • TheSEED:  
    Nucleosides and NucleotidesPurinesDe Novo Purine Biosynthesis Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3) 
  • PFAM:
    Glutaminase_I (CL0014) GATase_5; CobB/CobQ-like glutamine amidotransferase domain (PF13507; HMM-score: 155.3)
    GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 32.7)
    GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 30)
    DJ-1_PfpI; DJ-1/PfpI family (PF01965; HMM-score: 29)
    Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 16.4)
    SNO; SNO glutamine amidotransferase family (PF01174; HMM-score: 13.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.187
    • Ymax_pos: 21
    • Cmax: 0.156
    • Cmax_pos: 21
    • Smax: 0.291
    • Smax_pos: 12
    • Smean: 0.202
    • D: 0.193
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]